PDB entry 2nts

View 2nts on RCSB PDB site
Description: Crystal Structure of SEK-hVb5.1
Class: toxin/immune system
Keywords: superantigen; T cell receptor, TOXIN-IMMUNE SYSTEM COMPLEX
Deposited on 2006-11-08, released 2007-06-26
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.219
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Staphylococcal enterotoxin K
  Species: Staphylococcus aureus subsp. aureus [TaxId:93062]
  Gene: sek
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5HHK0 (0-215)
    • conflict (72)
    • cloning artifact (216)
• Chain 'P':
  Compound: TRBC1 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: TRBC1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8N2T6 (0-239)
  Domains in SCOPe 2.02: d2ntsp1, d2ntsp2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'P':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ntsP (P:)
  gvtqtpryliktrgqqvtlscspisghrsvswyqqtpgqglqflfeyfnetqrnkgnfpg
  rfsgrqfsnsrsemnvstlelgdsalylcassladrvnteaffgqgtrltvvedlknvfp
  pevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplkeqpa
  lndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr