PDB entry 2ntj

View 2ntj on RCSB PDB site
Description: Mycobacterium tuberculosis InhA bound with PTH-NAD adduct
Class: oxidoreductase
Keywords: InhA, prothionamide, tuberculosis, OXIDOREDUCTASE
Deposited on 2006-11-07, released 2007-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.219
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: inhA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5Y6 (1-267)
      • engineered (0)
    Domains in SCOPe 2.08: d2ntja2, d2ntja3
  • Chain 'B':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: inhA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5Y6 (1-267)
      • engineered (0)
    Domains in SCOPe 2.08: d2ntjb2, d2ntjb3
  • Heterogens: P1H, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ntjA (A:)
    aglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
    eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
    isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
    ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
    vcallsdwlpattgdiiyadggahtqll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ntjB (B:)
    aglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
    eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
    isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
    ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
    vcallsdwlpattgdiiyadggahtqll