PDB entry 2nth

View 2nth on RCSB PDB site
Description: Structure of Spin-labeled T4 Lysozyme Mutant L118R1
Class: hydrolase
Keywords: Nitroxide, Spin label, T4 lysozyme, Electron paramagnetic resonance, EPR, HYDROLASE
Deposited on 2006-11-07, released 2007-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-163)
      • engineered (53)
      • engineered (96)
    Domains in SCOPe 2.07: d2ntha_
  • Heterogens: MTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nthA (A:)
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnscrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl