PDB entry 2ntg

View 2ntg on RCSB PDB site
Description: Structure of Spin-labeled T4 Lysozyme Mutant T115R7
Class: hydrolase
Keywords: Nitroxide, Spin label, T4 lysozyme, Electron paramagnetic resonance, EPR, HYDROLASE
Deposited on 2006-11-07, released 2007-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-163)
      • engineered mutation (53)
      • engineered mutation (96)
      • engineered mutation (114)
    Domains in SCOPe 2.08: d2ntga_
  • Heterogens: R7A, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ntgA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagfcnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl