PDB entry 2ntd

View 2ntd on RCSB PDB site
Description: Human fibroblast growth factor-1 (140 amino acid form) with Cys117Val/Pro134Cys mutations
Class: hormone/growth factor
Keywords: beta-trefoil, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2006-11-07, released 2007-07-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: 0.173
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acidic fibroblast growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230 (6-End)
      • expression tag (6)
      • engineered (122)
      • engineered (139)
    Domains in SCOPe 2.04: d2ntda_
  • Chain 'B':
    Compound: Acidic fibroblast growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230 (6-End)
      • expression tag (6)
      • engineered (122)
      • engineered (139)
    Domains in SCOPe 2.04: d2ntdb_
  • Chain 'C':
    Compound: Acidic fibroblast growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230 (6-End)
      • expression tag (6)
      • engineered (122)
      • engineered (139)
    Domains in SCOPe 2.04: d2ntdc_
  • Chain 'D':
    Compound: Acidic fibroblast growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230 (6-End)
      • expression tag (6)
      • engineered (122)
      • engineered (139)
    Domains in SCOPe 2.04: d2ntdd_
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ntdA (A:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkn
    gsvkrgprthygqkailflclpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ntdA (A:)
    hhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
    ikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkng
    svkrgprthygqkailflclpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ntdB (B:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkn
    gsvkrgprthygqkailflclpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ntdB (B:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkn
    gsvkrgprthygqkailflclpv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ntdC (C:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkn
    gsvkrgprthygqkailflclpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ntdC (C:)
    hhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
    ikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkng
    svkrgprthygqkailflclpv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ntdD (D:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkn
    gsvkrgprthygqkailflclpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ntdD (D:)
    hhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
    ikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkng
    svkrgprthygqkailflclpv