PDB entry 2nt3

View 2nt3 on RCSB PDB site
Description: Receiver domain from Myxococcus xanthus social motility protein FrzS (Y102A Mutant)
Class: signaling protein
Keywords: social motility, receiver domain, signalling, SIGNALING PROTEIN
Deposited on 2006-11-06, released 2007-03-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.134
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: response regulator homolog
    Species: MYXOCOCCUS XANTHUS [TaxId:34]
    Gene: FrzS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68522
      • engineered (104)
    Domains in SCOPe 2.06: d2nt3a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2nt3A (A:)
gshmskkilivesdtalsatlrsalegrgftvdettdgkgsveqirrdrpdlvvlavdls
agqngylicgklkkdddlknvpiviignpdgfaqhrklkahadeavakpvdadqlverag
aligfpe

    Sequence, based on observed residues (ATOM records): (download) 
    >2nt3A (A:)
skkilivesdtalsatlrsalegrgftvdettdgkgsveqirrdrpdlvvlavdlsagqn
gylicgklkkdddlknvpiviignpdgfaqhrklkahadeavakpvdadqlveragalig
fp