PDB entry 2nsz

View 2nsz on RCSB PDB site
Description: 1.15 Angstrom Crystal Structure of the MA3 domain of Pdcd4
Class: antitumor protein
Keywords: Pdcd4, tumor suppressor, translation, ANTITUMOR PROTEIN
Deposited on 2006-11-06, released 2006-11-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.133
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Programmed cell death protein 4
    Species: Mus musculus [TaxId:10090]
    Gene: Pdcd4, Ma3, Tis
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nsza1
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nszA (A:)
    qpvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestgesafk
    mildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagiisk
    qlrdlcpsr