PDB entry 2nss

View 2nss on RCSB PDB site
Description: Nitrobenzene Modified Horse Heart Myoglobin
Class: oxygen storage/transport
Keywords: nitroso, nitro, nitrite, nitric oxide, no, heme, myoglobin, OXYGEN STORAGE-TRANSPORT COMPLEX
Deposited on 2006-11-06, released 2007-11-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2nssa_
  • Heterogens: SO4, HEM, NBE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nssA (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nssA (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfq