SCOPe 2.05: Structural Classification of Proteins

PDB entry 2nsr

View 2nsr on RCSB PDB site
Description: Nitromethane Modified Horse Heart Myoglobin
Class: oxygen storage/transport
Keywords: Myoglobin, nitroso, nitro, nitric oxide, heme, nitrosomethane, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2006-11-06, released 2007-11-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.163
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Myoglobin
Species: Equus caballus [TaxId:9796]
Database cross-references and differences (RAF-indexed):
- Uniprot P68082 (0-End)
Domains in SCOPe 2.05: d2nsra_
Heterogens: SO4, HEM, NSM, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>2nsrA (A:)
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

Sequence, based on observed residues (ATOM records): (download)

>2nsrA (A:)
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq