PDB entry 2nsq

View 2nsq on RCSB PDB site
Description: Crystal structure of the C2 domain of the human E3 ubiquitin-protein ligase NEDD4-like protein
Class: ligase
Keywords: ligase, ubl-conjugation pathway, c2 domain, structural genomics consortium, sgc
Deposited on 2006-11-06, released 2006-12-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.174
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase NEDD4-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: NEDD4L, KIAA0439, NEDL3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2nsqa_
  • Heterogens: EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2nsqA (A:)
gmatglgepvyglsedegesrilrvkvvsgidlakkdifgasdpyvklslyvadenrela
lvqtktikktlnpkwneefyfrvnpsnhrllfevfdenrltrddflgqvdvplshlpted
ptmerpytfkdfllrprshksrvkgflrlkmaymp

    Sequence, based on observed residues (ATOM records): (download) 
    >2nsqA (A:)
gepvyglsedegesrilrvkvvsgidlakkasdpyvklslyvadenrelalvqtktikkt
lnpkwneefyfrvnpsnhrllfevfdenrltrddflgqvdvplshlptedpytfkdfllr
prshksrvkgflrlkmaymp