PDB entry 2ns7

View 2ns7 on RCSB PDB site
Description: How an in vitro selected peptide mimics the antibiotic tetracycline to induce TET repressor
Class: Transcription
Keywords: transcription regulator, helix-turn-helix, Transcription
Deposited on 2006-11-03, released 2007-07-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.234
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tetracycline repressor protein
    Species: Escherichia coli [TaxId:83333]
    Gene: tetR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04483 (Start-186)
      • engineered (67)
      • engineered (87)
      • engineered (120)
      • engineered (143)
    • Uniprot P0ACT4 (187-End)
    Domains in SCOPe 2.06: d2ns7a1, d2ns7a2
  • Chain 'B':
    Compound: Tetracycline repressor protein
    Species: Escherichia coli [TaxId:83333]
    Gene: tetR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04483 (Start-186)
      • engineered (67)
      • engineered (87)
      • engineered (120)
      • engineered (143)
    • Uniprot P0ACT4 (187-End)
    Domains in SCOPe 2.06: d2ns7b1, d2ns7b2
  • Chain 'C':
    Compound: Tetracycline repressor protein
    Species: Escherichia coli [TaxId:83333]
    Gene: tetR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04483 (Start-186)
      • engineered (67)
      • engineered (87)
      • engineered (120)
      • engineered (143)
    • Uniprot P0ACT4 (187-End)
    Domains in SCOPe 2.06: d2ns7c1, d2ns7c2
  • Chain 'D':
    Compound: Tetracycline repressor protein
    Species: Escherichia coli [TaxId:83333]
    Gene: tetR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04483 (Start-186)
      • engineered (67)
      • engineered (87)
      • engineered (120)
      • engineered (143)
    • Uniprot P0ACT4 (187-End)
    Domains in SCOPe 2.06: d2ns7d1, d2ns7d2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ns7A (A:)
    msrldkskvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaieml
    drhhthfsplegeswqdflrnnaksfrnallshrdgakvhlgtrptekqyetlenqlafl
    tqqgfslenalyalsavghftlgsvledqehqvakeeretpttdsmppllrqaielfdhq
    gaepaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ns7A (A:)
    dkskvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaiemldrhh
    thfsplegeswqdflrnnaksfrnallshrdgakvhlgtrptekqyetlenqlafltqqg
    fslenalyalsavghftlgsvledqehqvakttdsmppllrqaielfdhqgaepaflhgl
    eslirgfevqltallq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ns7B (B:)
    msrldkskvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaieml
    drhhthfsplegeswqdflrnnaksfrnallshrdgakvhlgtrptekqyetlenqlafl
    tqqgfslenalyalsavghftlgsvledqehqvakeeretpttdsmppllrqaielfdhq
    gaepaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ns7B (B:)
    rldkskvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaiemldr
    hhthfsplegeswqdflrnnaksfrnallshrdgakvhlgtrptekqyetlenqlafltq
    qgfslenalyalsavghftlgsvledqehqvakdsmppllrqaielfdhqgaepaflhgl
    eslirgfevqltal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ns7C (C:)
    msrldkskvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaieml
    drhhthfsplegeswqdflrnnaksfrnallshrdgakvhlgtrptekqyetlenqlafl
    tqqgfslenalyalsavghftlgsvledqehqvakeeretpttdsmppllrqaielfdhq
    gaepaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ns7C (C:)
    skvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaiemldrhhth
    fsplegeswqdflrnnaksfrnallshrdgakvhlgtrptekqyetlenqlafltqqgfs
    lenalyalsavghftlgsvledqehqvakttdsmppllrqaielfdhqgaepaflhgles
    lirgfevqlt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ns7D (D:)
    msrldkskvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaieml
    drhhthfsplegeswqdflrnnaksfrnallshrdgakvhlgtrptekqyetlenqlafl
    tqqgfslenalyalsavghftlgsvledqehqvakeeretpttdsmppllrqaielfdhq
    gaepaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ns7D (D:)
    ldkskvinsalellnevgieglttrklaqklgveqptlywhvknkralldalaiemldrh
    hthfsplegeswqdflrnnaksfrnallshrdgakvhlgtrptekqyetlenqlafltqq
    gfslenalyalsavghftlgsvledqehqvakegaepaflhgleslirgfevqltall