PDB entry 2nrp

View 2nrp on RCSB PDB site
Description: MoeA R350A
Class: biosynthetic protein
Keywords: molybdopterin, MPT, Moco, molybdenum, MoeA, MogA, gephyrin, Cnx1, cinnamon, BIOSYNTHETIC PROTEIN
Deposited on 2006-11-02, released 2007-01-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.221
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Molybdopterin biosynthesis protein moeA
    Species: Escherichia coli [TaxId:562]
    Gene: moeA, bisB, chlE, narE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12281
      • engineered (349)
    Domains in SCOPe 2.06: d2nrpa1, d2nrpa2, d2nrpa3
  • Chain 'B':
    Compound: Molybdopterin biosynthesis protein moeA
    Species: Escherichia coli [TaxId:562]
    Gene: moeA, bisB, chlE, narE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12281 (Start-410)
      • engineered (349)
    Domains in SCOPe 2.06: d2nrpb1, d2nrpb2, d2nrpb3
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nrpA (A:)
    mefttglmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdg
    yavrladiasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqm
    dngvrftaevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrv
    alfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafiea
    dsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgn
    pvsatltfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqagvlqrnadge
    levtttghqgshifssfslgncfivlerdrgnvevgewvevepfnalfggl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nrpA (A:)
    lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
    diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
    taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrvalfstg
    delqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafieadsqadv
    vissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgnpvsatl
    tfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqagvlqrnadgelevttt
    ghqgshifssfslgncfivlerdrgnvevgewvevepfnalfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nrpB (B:)
    mefttglmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdg
    yavrladiasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqm
    dngvrftaevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrv
    alfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafiea
    dsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgn
    pvsatltfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqagvlqrnadge
    levtttghqgshifssfslgncfivlerdrgnvevgewvevepfnalfggl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nrpB (B:)
    lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
    diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
    taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrvalfstg
    delqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafieadsqadv
    vissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgnpvsatl
    tfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqagvlqrnadgelevttt
    ghqgshifssfslgncfivlerdrgnvevgewvevepfnalfggl