PDB entry 2nrm

View 2nrm on RCSB PDB site
Description: S-nitrosylated blackfin tuna myoglobin
Class: transport protein
Keywords: S-nitrosylation, myoglobin, globin, TRANSPORT PROTEIN
Deposited on 2006-11-02, released 2007-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.09 Å
R-factor: 0.134
AEROSPACI score: 0.96 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Thunnus atlanticus [TaxId:48168]
    Database cross-references and differences (RAF-indexed):
    • PDB 2NRM (Start-145)
    Domains in SCOPe 2.07: d2nrma_
  • Heterogens: HEM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nrmA (A:)
adfdavlkcwgpveadyttigglvltrlfkehpetqklfpkfagiaqadiagnaavsahg
atvlkklgellkakgshaailkplanshatkhkipinnfklisevlvkvmqekagldagg
qtalrnvmgiiiadleanykelgfsg