PDB entry 2nrk

View 2nrk on RCSB PDB site
Description: Crystal structure of conserved protein GrpB from Enterococcus faecalis
Class: structural genomics, unknown function
Keywords: UPF0157, pfam04229, glutamate-rich protein, Enterococcus faecalis, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2006-11-02, released 2006-12-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.179
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein GrpB
    Species: Enterococcus faecalis [TaxId:226185]
    Gene: UPF0157
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q837C3 (Start-172)
      • modified residue (80)
      • modified residue (152)
    Domains in SCOPe 2.02: d2nrka1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2nrkA (A:)
snamrvivteyqpawveqfeeeaqalkqilkenclkvehigstsvpnlaakpiidflviv
eeiekvdllqweferigyeymgefglsgrrylrkgpikrthhvhiyqfdntqeilrhlaf
rnylrenpaiattygtlkkqlaqahpdsidkymdgkdafikkiekealkkywe

    Sequence, based on observed residues (ATOM records): (download) 
    >2nrkA (A:)
ivteyqpawveqfeeeaqalkqilkenclkvehigstsvpnlaakpiidflviveeiekv
dllqweferigyeymgefglsgrrylrkgpikrthhvhiyqfdntqeilrhlafrnylre
npaiattygtlkkqlaqahpdsidkymkdafikkiekealkkywe