PDB entry 2nrd

View 2nrd on RCSB PDB site
Description: the structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type II cu depleted
Class: oxidoreductase (nitric oxide(a))
Keywords: oxidoreductase (nitric oxide(a))
Deposited on 1995-07-03, released 1995-12-07
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.164
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrite reductase
    Species: Achromobacter cycloclastes
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2nrda1, d2nrda2
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nrdA (A:)
    aagaapvdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteih
    amtfngsvpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeet
    tlrfkatkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvge
    qdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavger
    vlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgv
    yayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nrdA (A:)
    distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
    vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
    kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvgeqdfyvpk
    deagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavgervlvvhsq
    anrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgvyayvnhn
    lieafelgaaghfkvtgewnddlmtsvvkpasm