PDB entry 2nrc

View 2nrc on RCSB PDB site
Description: C28A Mutant of Succinyl-CoA:3-Ketoacid CoA Transferase from Pig Heart
Class: transferase
Keywords: alpha/beta protein, transferase
Deposited on 2006-11-01, released 2007-09-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.231
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinyl-CoA:3-ketoacid-coenzyme A transferase 1
    Species: Sus scrofa [TaxId:9823]
    Gene: OXCT1, OXCT, SCOT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29551 (0-End)
      • engineered (27)
    Domains in SCOPe 2.08: d2nrca1, d2nrca2
  • Chain 'B':
    Compound: Succinyl-CoA:3-ketoacid-coenzyme A transferase 1
    Species: Sus scrofa [TaxId:9823]
    Gene: OXCT1, OXCT, SCOT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29551 (0-End)
      • engineered (27)
    Domains in SCOPe 2.08: d2nrcb1, d2nrcb2
  • Chain 'C':
    Compound: Succinyl-CoA:3-ketoacid-coenzyme A transferase 1
    Species: Sus scrofa [TaxId:9823]
    Gene: OXCT1, OXCT, SCOT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29551 (0-End)
      • engineered (27)
    Domains in SCOPe 2.08: d2nrcc1, d2nrcc2
  • Chain 'D':
    Compound: Succinyl-CoA:3-ketoacid-coenzyme A transferase 1
    Species: Sus scrofa [TaxId:9823]
    Gene: OXCT1, OXCT, SCOT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29551 (0-End)
      • engineered (27)
    Domains in SCOPe 2.08: d2nrcd1, d2nrcd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nrcA (A:)
    tkfytdaveavkdipngatvlvggfglagipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
    nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
    erlsvrkeedvktrsgklgdnvreriikraalefedgmyanlgigipllasnfispnmtv
    hlqsengilglgpyplqnevdadlinagketvtvlpgasyfssdesfamirgghvnltml
    gamqvskygdlanwmipgklvkgmggamdlvssaktkvvvtmehsakgnahkimekctlp
    ltgkqcvnriitekavfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvt
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nrcA (A:)
    tkfytdaveavkdipngatvlvggfglagipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
    nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
    erlsvrknvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgp
    yplqnevdadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlan
    wmipgklvkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriite
    kavfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nrcB (B:)
    tkfytdaveavkdipngatvlvggfglagipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
    nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
    erlsvrkeedvktrsgklgdnvreriikraalefedgmyanlgigipllasnfispnmtv
    hlqsengilglgpyplqnevdadlinagketvtvlpgasyfssdesfamirgghvnltml
    gamqvskygdlanwmipgklvkgmggamdlvssaktkvvvtmehsakgnahkimekctlp
    ltgkqcvnriitekavfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvt
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nrcB (B:)
    tkfytdaveavkdipngatvlvggfglagipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
    nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
    erlsvrkeklgdnvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengi
    lglgpyplqnevdadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvsky
    gdlanwmipgklvkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvn
    riitekavfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2nrcC (C:)
    tkfytdaveavkdipngatvlvggfglagipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
    nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
    erlsvrkeedvktrsgklgdnvreriikraalefedgmyanlgigipllasnfispnmtv
    hlqsengilglgpyplqnevdadlinagketvtvlpgasyfssdesfamirgghvnltml
    gamqvskygdlanwmipgklvkgmggamdlvssaktkvvvtmehsakgnahkimekctlp
    ltgkqcvnriitekavfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvt
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nrcC (C:)
    tkfytdaveavkdipngatvlvggfglagipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
    nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
    erlsvrknvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgp
    yplqnevdadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlan
    wmipgklvkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriite
    kavfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2nrcD (D:)
    tkfytdaveavkdipngatvlvggfglagipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
    nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
    erlsvrkeedvktrsgklgdnvreriikraalefedgmyanlgigipllasnfispnmtv
    hlqsengilglgpyplqnevdadlinagketvtvlpgasyfssdesfamirgghvnltml
    gamqvskygdlanwmipgklvkgmggamdlvssaktkvvvtmehsakgnahkimekctlp
    ltgkqcvnriitekavfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvt
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nrcD (D:)
    tkfytdaveavkdipngatvlvggfglagipenligallktgvkeltavsnnagvdnfgl
    glllqskqikrmissyvgenaeferqylageleveltpqgtlaeriraggagvpafytst
    gygtlvqeggspikynkdgsiaiaskprevrefngqhfileeairgdfalvkawkadqag
    nvtfrksarnfnlpmckaaettvveveeivdigsfapedihipkiyvhrlvkgekyekri
    erlsvrkgdnvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilgl
    gpyplqnevdadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdl
    anwmipgklvkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnrii
    tekavfdvdrkkgltlielwegltvddikkstgcdfavspklipmqqvt