PDB entry 2nr6

View 2nr6 on RCSB PDB site
Description: Crystal structure of the complex of antibody and the allergen Bla g 2
Class: hydrolase/immune system
Keywords: Bla g 2, Fab, HYDROLASE-IMMUNE SYSTEM COMPLEX
Deposited on 2006-11-01, released 2008-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartic protease Bla g 2
    Species: Blattella germanica [TaxId:6973]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54958 (13-322)
      • expression tag (0-3)
      • engineered (101)
    Domains in SCOPe 2.07: d2nr6a1, d2nr6a2
  • Chain 'B':
    Compound: Aspartic protease Bla g 2
    Species: Blattella germanica [TaxId:6973]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54958 (13-322)
      • expression tag (0-3)
      • engineered (101)
    Domains in SCOPe 2.07: d2nr6b1, d2nr6b2
  • Chain 'C':
    Compound: Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2NR6 (0-210)
    Domains in SCOPe 2.07: d2nr6c1, d2nr6c2
  • Chain 'D':
    Compound: antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2NR6 (0-212)
    Domains in SCOPe 2.07: d2nr6d1
  • Chain 'E':
    Compound: Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2NR6 (0-210)
    Domains in SCOPe 2.07: d2nr6e1, d2nr6e2
  • Chain 'F':
    Compound: antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2NR6 (0-212)
    Domains in SCOPe 2.07: d2nr6f1
  • Heterogens: NAG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nr6A (A:)
    gasivplyklvhvfintqyagitkignqnfltvfdstscnvvvasqecvggacvcpnlqk
    yeklkpkyisdgnvqvkffdtgsavgrgiedsltisqlttsqqdivladelsqevcilsa
    dvvvgiaapgcpnalkgktvlenfveenliapvfsihharfqdgehfgeiifggsdwkyv
    dgeftyvplvgddswkfrldgvkigdttvapagtqaiidtskaiivgpkayvnpineaig
    cvvektttrrickldcskipslpdvtfvingrnfnissqyyiqqngnlcysgfqpcghsd
    hffigdffvdhyysefnwenktmgfgrsve
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nr6B (B:)
    gasivplyklvhvfintqyagitkignqnfltvfdstscnvvvasqecvggacvcpnlqk
    yeklkpkyisdgnvqvkffdtgsavgrgiedsltisqlttsqqdivladelsqevcilsa
    dvvvgiaapgcpnalkgktvlenfveenliapvfsihharfqdgehfgeiifggsdwkyv
    dgeftyvplvgddswkfrldgvkigdttvapagtqaiidtskaiivgpkayvnpineaig
    cvvektttrrickldcskipslpdvtfvingrnfnissqyyiqqngnlcysgfqpcghsd
    hffigdffvdhyysefnwenktmgfgrsve
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nr6C (C:)
    divmtqshkfmstsvgdrvsitckasqivstavawyqqkpgqspklliysasyrytgvpd
    rftgsgsgtdftftissvqaedlavyycqqhynspqtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nr6D (D:)
    eiqlqqsgaelvkpgasvklsctasgfnikdtyihwvkqrpeqglewigridpangntry
    gpkflgkatitadtssntaylhlnsltsedtavyfcarwvrqmdywgqgtsvtvssaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkki
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nr6E (E:)
    divmtqshkfmstsvgdrvsitckasqivstavawyqqkpgqspklliysasyrytgvpd
    rftgsgsgtdftftissvqaedlavyycqqhynspqtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nr6F (F:)
    eiqlqqsgaelvkpgasvklsctasgfnikdtyihwvkqrpeqglewigridpangntry
    gpkflgkatitadtssntaylhlnsltsedtavyfcarwvrqmdywgqgtsvtvssaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkki