PDB entry 2nr4

View 2nr4 on RCSB PDB site
Description: Crystal structure of FMN-bound protein MM1853 from Methanosarcina mazei, Pfam DUF447
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, FLAVOPROTEIN, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2006-11-01, released 2006-11-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Methanosarcina mazei [TaxId:2209]
    Gene: MM_1853
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nr4a1
  • Chain 'B':
    Compound: conserved hypothetical protein
    Species: Methanosarcina mazei [TaxId:2209]
    Gene: MM_1853
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nr4b_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nr4A (A:)
    sligflsdrqgfekqyhdidlssfgiregiseiiastgfehpnaapigivmkgerpfvrl
    fkgshtwenvlkekclasnvvydpilfvrstfsdlvpsefeyvdagefkfpvlkeaiawv
    vfecinlrntdqslvadlvplnagfnernikelpvpnrgfnavleatvhatryqltgeek
    ylelirhyeslaskcggdaekkamkliyealgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nr4A (A:)
    dlssfgiregiseiiastgfehpnaapigivmkgerpfvrlfkgshtwenvlkekclasn
    vvydpilfvrstfsdlvpsefeyvdgefkfpvlkeaiawvvfecinlrntdqslvadlvp
    lnagfnernikelpvpnrgfnavleatvhatryqltgeekylelirhyeslaskcggdae
    kkamkliyeal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nr4B (B:)
    sligflsdrqgfekqyhdidlssfgiregiseiiastgfehpnaapigivmkgerpfvrl
    fkgshtwenvlkekclasnvvydpilfvrstfsdlvpsefeyvdagefkfpvlkeaiawv
    vfecinlrntdqslvadlvplnagfnernikelpvpnrgfnavleatvhatryqltgeek
    ylelirhyeslaskcggdaekkamkliyealgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nr4B (B:)
    dlssfgiregiseiiastgfehpnaapigivmkgerpfvrlfkgshtwenvlkekclasn
    vvydpilfvrstflvpsefeyvdagefkfpvlkeaiawvvfecinlrntslvadlvplna
    gfnernikelpvpnrgfnavleatvhatryqylelirhyeslaskcggdaekkamkliye
    al