PDB entry 2nr0

View 2nr0 on RCSB PDB site
Description: Crystal structure of pseudoudirinde synthase TruA in complex with leucyl tRNA
Class: isomerase/RNA
Keywords: pseudouridine synthase, anticodon stem loop, tRNA, multisite specificity, ISOMERASE/RNA COMPLEX
Deposited on 2006-11-01, released 2007-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.9 Å
R-factor: 0.298
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA pseudouridine synthase A
    Species: Escherichia coli [TaxId:83333]
    Gene: truA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nr0a1
  • Chain 'B':
    Compound: tRNA pseudouridine synthase A
    Species: Escherichia coli [TaxId:83333]
    Gene: truA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nr0b1
  • Chain 'C':
    Compound: tRNA pseudouridine synthase A
    Species: Escherichia coli [TaxId:83333]
    Gene: truA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nr0c1
  • Chain 'D':
    Compound: tRNA pseudouridine synthase A
    Species: Escherichia coli [TaxId:83333]
    Gene: truA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nr0d1
  • Chain 'E':
    Compound: leucyl tRNA
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: leucyl tRNA
    Species: synthetic, synthetic
  • Chain 'G':
    Compound: leucyl tRNA
    Species: synthetic, synthetic
  • Chain 'H':
    Compound: leucyl tRNA
    Species: synthetic, synthetic

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nr0A (A:)
    msdqqqppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtd
    agvhgtgqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryry
    iiynhrlrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmh
    invtrhgpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaata
    kaeglylvavdypdrydlpkppmgplflad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nr0A (A:)
    ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt
    gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr
    lrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrh
    gpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaegly
    lvavdypdrydlpkppmgplflad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nr0B (B:)
    msdqqqppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtd
    agvhgtgqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryry
    iiynhrlrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmh
    invtrhgpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaata
    kaeglylvavdypdrydlpkppmgplflad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nr0B (B:)
    ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt
    gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr
    lrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrh
    gpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaegly
    lvavdypdrydlpkppmgplflad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2nr0C (C:)
    msdqqqppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtd
    agvhgtgqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryry
    iiynhrlrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmh
    invtrhgpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaata
    kaeglylvavdypdrydlpkppmgplflad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nr0C (C:)
    ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt
    gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr
    lrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrh
    gpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaegly
    lvavdypdrydlpkppmgplflad
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2nr0D (D:)
    msdqqqppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtd
    agvhgtgqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryry
    iiynhrlrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmh
    invtrhgpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaata
    kaeglylvavdypdrydlpkppmgplflad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nr0D (D:)
    ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt
    gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr
    lrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrh
    gpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaegly
    lvavdypdrydlpkppmgplflad
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.