PDB entry 2nqy

View 2nqy on RCSB PDB site
Description: Crystal structure of alkaline thermophlic xylanase from Bacillus sp. (NCL 86-6-10) with complex xylotriose: Xylotriose cleaved to xylobiose and xylose
Class: hydrolase
Keywords: alkaline xylanase, active site residues, three-dimentional structure, xylotrise, xylobiose, xylose, hydrolase
Deposited on 2006-11-01, released 2007-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: family 11 xylanase
    Species: Bacillus sp. [TaxId:1409]
    Database cross-references and differences (RAF-indexed):
    • PDB 2NQY (0-205)
    Domains in SCOPe 2.07: d2nqya_
  • Chain 'B':
    Compound: family 11 xylanase
    Species: Bacillus sp. [TaxId:1409]
    Database cross-references and differences (RAF-indexed):
    • PDB 2NQY (0-205)
    Domains in SCOPe 2.07: d2nqyb_
  • Heterogens: BXP, XYP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nqyA (A:)
    eivtdnstgnhdgydyefwkdsggsgtmilnsggtfsaswssvsnilfrkgkkfnetqth
    qqvgnmsisyganfqpsgnaylcvygwtvsplveyyivdswgnwrppgatpkgtitvdgg
    tydiyetdrtnqpsikgvatfsqywstrrskrtsgtisvsnhfraweslgmnmgdmyeva
    ltvegyqssgsanvysntlringnpl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nqyB (B:)
    eivtdnstgnhdgydyefwkdsggsgtmilnsggtfsaswssvsnilfrkgkkfnetqth
    qqvgnmsisyganfqpsgnaylcvygwtvsplveyyivdswgnwrppgatpkgtitvdgg
    tydiyetdrtnqpsikgvatfsqywstrrskrtsgtisvsnhfraweslgmnmgdmyeva
    ltvegyqssgsanvysntlringnpl