PDB entry 2nqu

View 2nqu on RCSB PDB site
Description: MoeA E188Q
Class: biosynthetic protein
Keywords: molybdopterin, MPT, Moco, molybdenum, MoeA, MogA, gephyrin, Cnx1, cinnamon
Deposited on 2006-10-31, released 2007-01-16
The last revision prior to the SCOP 1.75 freeze date was dated 2007-01-16, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.205
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Molybdopterin biosynthesis protein moeA
    Species: Escherichia coli
    Gene: moeA, bisB, chlE, narE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12281
      • engineered (187)
    Domains in SCOP 1.75: d2nqua1, d2nqua2, d2nqua3
  • Chain 'B':
    Compound: Molybdopterin biosynthesis protein moeA
    Species: Escherichia coli
    Gene: moeA, bisB, chlE, narE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12281
      • engineered (187)
    Domains in SCOP 1.75: d2nqub1, d2nqub2, d2nqub3
  • Heterogens: GOL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nquA (A:)
    mefttglmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdg
    yavrladiasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqm
    dngvrftaevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrv
    alfstgdqlqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafiea
    dsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgn
    pvsatltfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadge
    levtttghqgshifssfslgncfivlerdrgnvevgewvevepfnalfggl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nquA (A:)
    lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
    diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
    taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrvalfstg
    dqlqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafieadsqadv
    vissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgnpvsatl
    tfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadgelevttt
    ghqgshifssfslgncfivlerdrgnvevgewvevepfnalfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nquB (B:)
    mefttglmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdg
    yavrladiasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqm
    dngvrftaevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrv
    alfstgdqlqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafiea
    dsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgn
    pvsatltfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadge
    levtttghqgshifssfslgncfivlerdrgnvevgewvevepfnalfggl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nquB (B:)
    glmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrl
    adiasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvr
    ftaevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrvalfst
    gdqlqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafieadsqad
    vvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgnpvsat
    ltfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadgelevtt
    tghqgshifssfslgncfivlerdrgnvevgewvevepfnalfg