PDB entry 2nqq

View 2nqq on RCSB PDB site
Description: MoeA R137Q
Class: biosynthetic protein
Keywords: molybdopterin, MPT, Moco, molybdenum, MoeA, MogA, gephyrin, Cnx1, cinnamon, BIOSYNTHETIC PROTEIN
Deposited on 2006-10-31, released 2007-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.193
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Molybdopterin biosynthesis protein moeA
    Species: Escherichia coli [TaxId:562]
    Gene: moeA, bisB, chlE, narE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12281
      • engineered (136)
    Domains in SCOPe 2.07: d2nqqa1, d2nqqa2, d2nqqa3
  • Chain 'B':
    Compound: Molybdopterin biosynthesis protein moeA
    Species: Escherichia coli [TaxId:562]
    Gene: moeA, bisB, chlE, narE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12281
      • engineered (136)
    Domains in SCOPe 2.07: d2nqqb1, d2nqqb2, d2nqqb3
  • Chain 'C':
    Compound: Molybdopterin biosynthesis protein moeA
    Species: Escherichia coli [TaxId:562]
    Gene: moeA, bisB, chlE, narE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12281
      • engineered (136)
    Domains in SCOPe 2.07: d2nqqc1, d2nqqc2, d2nqqc3
  • Chain 'D':
    Compound: Molybdopterin biosynthesis protein moeA
    Species: Escherichia coli [TaxId:562]
    Gene: moeA, bisB, chlE, narE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12281
      • engineered (136)
    Domains in SCOPe 2.07: d2nqqd1, d2nqqd2, d2nqqd3
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nqqA (A:)
    mefttglmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdg
    yavrladiasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqm
    dngvrftaevrsgqniqrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrv
    alfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafiea
    dsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgn
    pvsatltfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadge
    levtttghqgshifssfslgncfivlerdrgnvevgewvevepfnalfggl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nqqA (A:)
    lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
    diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
    taevrsgqniqrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrvalfstg
    delqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafieadsqadv
    vissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgnpvsatl
    tfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadgelevttt
    ghqgshifssfslgncfivlerdrgnvevgewvevepfnalfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nqqB (B:)
    mefttglmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdg
    yavrladiasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqm
    dngvrftaevrsgqniqrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrv
    alfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafiea
    dsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgn
    pvsatltfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadge
    levtttghqgshifssfslgncfivlerdrgnvevgewvevepfnalfggl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nqqB (B:)
    lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
    diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
    taevrsgqniqrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrvalfstg
    delqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafieadsqadv
    vissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgnpvsatl
    tfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadgelevttt
    ghqgshifssfslgncfivlerdrgnvevgewvevepfnalfg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2nqqC (C:)
    mefttglmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdg
    yavrladiasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqm
    dngvrftaevrsgqniqrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrv
    alfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafiea
    dsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgn
    pvsatltfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadge
    levtttghqgshifssfslgncfivlerdrgnvevgewvevepfnalfggl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nqqC (C:)
    lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
    diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
    taevrsgqniqrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrvalfstg
    delqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafieadsqadv
    vissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgnpvsatl
    tfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadgelevttt
    ghqgshifssfslgncfivlerdrgnvevgewvevepfnalfg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2nqqD (D:)
    mefttglmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdg
    yavrladiasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqm
    dngvrftaevrsgqniqrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrv
    alfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafiea
    dsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgn
    pvsatltfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadge
    levtttghqgshifssfslgncfivlerdrgnvevgewvevepfnalfggl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nqqD (D:)
    lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
    diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
    taevrsgqniqrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrvalfstg
    delqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafieadsqadv
    vissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgnpvsatl
    tfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadgelevttt
    ghqgshifssfslgncfivlerdrgnvevgewvevepfnalfg