PDB entry 2nqp

View 2nqp on RCSB PDB site
Description: Crystal structure of pseudoudirinde synthase TruA in complex with leucyl tRNA
Class: isomerase/RNA
Keywords: pseudouridine synthase, anticodon stem loop, tRNA, multisite specificity, ISOMERASE/RNA COMPLEX
Deposited on 2006-10-31, released 2007-05-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.249
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA pseudouridine synthase A
    Species: Escherichia coli [TaxId:83333]
    Gene: truA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2nqpa1
  • Chain 'B':
    Compound: tRNA pseudouridine synthase A
    Species: Escherichia coli [TaxId:83333]
    Gene: truA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2nqpb1
  • Chain 'C':
    Compound: tRNA pseudouridine synthase A
    Species: Escherichia coli [TaxId:83333]
    Gene: truA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2nqpc1
  • Chain 'D':
    Compound: tRNA pseudouridine synthase A
    Species: Escherichia coli [TaxId:83333]
    Gene: truA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2nqpd1
  • Chain 'F':
    Compound: transfer RNA
    Species: synthetic, synthetic
  • Heterogens: K

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nqpA (A:)
    msdqqqppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtd
    agvhgtgqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryry
    iiynhrlrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmh
    invtrhgpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaata
    kaeglylvavdypdrydlpkppmgplflad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nqpA (A:)
    ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt
    gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr
    lrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrh
    gpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaegly
    lvavdypdrydlpkppmgplflad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nqpB (B:)
    msdqqqppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtd
    agvhgtgqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryry
    iiynhrlrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmh
    invtrhgpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaata
    kaeglylvavdypdrydlpkppmgplflad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nqpB (B:)
    ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt
    gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr
    lrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrh
    gpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaegly
    lvavdypdrydlpkppmgplflad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2nqpC (C:)
    msdqqqppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtd
    agvhgtgqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryry
    iiynhrlrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmh
    invtrhgpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaata
    kaeglylvavdypdrydlpkppmgplflad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nqpC (C:)
    ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt
    gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr
    lrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrh
    gpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaegly
    lvavdypdrydlpkppmgplflad
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2nqpD (D:)
    msdqqqppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtd
    agvhgtgqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryry
    iiynhrlrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmh
    invtrhgpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaata
    kaeglylvavdypdrydlpkppmgplflad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nqpD (D:)
    pvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgtg
    qvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhrl
    rpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrhg
    pyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaeglyl
    vavdypdrydlpkppmgplflad
    

  • Chain 'F':
    No sequence available.