PDB entry 2nqm

View 2nqm on RCSB PDB site
Description: MoeA T100A mutant
Class: biosynthetic protein
Keywords: molybdopterin, MPT, Moco, molybdenum, MoeA, MogA, gephyrin, Cnx1, cinnamon, BIOSYNTHETIC PROTEIN
Deposited on 2006-10-31, released 2007-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.272
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Molybdopterin biosynthesis protein moeA
    Species: Escherichia coli [TaxId:562]
    Gene: moeA, bisB, chlE, narE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nqma1, d2nqma2, d2nqma3
  • Chain 'B':
    Compound: Molybdopterin biosynthesis protein moeA
    Species: Escherichia coli [TaxId:562]
    Gene: moeA, bisB, chlE, narE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12281
      • engineered (99)
    Domains in SCOPe 2.07: d2nqmb1, d2nqmb2, d2nqmb3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nqmA (A:)
    mefttglmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdg
    yavrladiasgqplpvagksfagqpyhgewpagtcirimagapvpegceavvmqeqteqm
    dngvrftaevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrv
    alfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafiea
    dsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgn
    pvsatltfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadge
    levtttghqgshifssfslgncfivlerdrgnvevgewvevepfnalfggl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nqmA (A:)
    lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnrrrgedisaga
    vvfpagtrlttaelpviaslgiaevpvirkvrvalfstgdelqlpgqplgdgqiydtnrl
    avhlmleqlgcevinlgiirddphalraafieadsqadvvissggvsvgeadytktilee
    lgeiafwklaikpgkpfafgklsnswfcglpgnpvsatltfyqlvqpllaklsgntasgl
    parqrvrtasrlkktpgrldfqrgvlqrnadgelevtttghqgshifssfslgncfivle
    rdrgnvevgewvevepfnalfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nqmB (B:)
    mefttglmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdg
    yavrladiasgqplpvagksfagqpyhgewpagtcirimagapvpegceavvmqeqteqm
    dngvrftaevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrv
    alfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafiea
    dsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgn
    pvsatltfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadge
    levtttghqgshifssfslgncfivlerdrgnvevgewvevepfnalfggl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nqmB (B:)
    lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
    diasgqplpvagksfagqpyhgewpagtcirimagapvpegceavvmqeqteqmdngvrf
    taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrvalfstg
    delqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafieadsqadv
    vissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgnpvsatl
    tfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadgelevttt
    ghqgshifssfslgncfivlerdrgnvevgewvevepfnalfg