PDB entry 2nqi

View 2nqi on RCSB PDB site
Description: Calpain 1 proteolytic core inactivated by WR13(R,R), an epoxysuccinyl-type inhibitor.
Class: hydrolase
Keywords: epoxide, epoxysuccinyl, protease, peptidase, proteinase, inactivator, inhibitor, hydrolase
Deposited on 2006-10-31, released 2007-01-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calpain-1 catalytic subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Capn1, Cls1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nqia_
  • Heterogens: CA, NQI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nqiA (A:)
    mglgrhenaikylgqdyenlrarclqngvlfqddafppvshslgfkelgpnssktygikw
    krptellsnpqfivdgatrtdicqgalgdcwllaaiasltlnetilhrvvpygqsfqegy
    agifhfqlwqfgewvdvvvddllptkdgklvfvhsaqgnefwsallekayakvngsyeal
    sggctseafedftggvtewydlqkapsdlyqiilkalergsllgcsinisdirdleaitf
    knlvrghaysvtdakqvtyqgqrvnlirmrnpwgevewkgpwsdnsyewnkvdpyereql
    rvkmedgefwmsfrdfireftkleicnltpdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nqiA (A:)
    naikylgqdyenlrarclqngvlfqddafppvshslgfkelgpnssktygikwkrptell
    snpqfivdgatrtdicqgalgdcwllaaiasltlnetilhrvvpygqsfqegyagifhfq
    lwqfgewvdvvvddllptkdgklvfvhsaqgnefwsallekayakvngsyealsggctse
    afedftggvtewydlqkapsdlyqiilkalergsllgcsinisdirdleaitfknlvrgh
    aysvtdakqvtyqgqrvnlirmrnpwgevewkgpwsdnsyewnkvdpyereqlrvkmedg
    efwmsfrdfireftkleicnlt