PDB entry 2nqh

View 2nqh on RCSB PDB site
Description: High Resolution crystal structure of Escherichia coli endonuclease IV (Endo IV) E261Q mutant
Class: hydrolase
Keywords: Tim-Barrel, trinuclear zinc center, HYDROLASE
Deposited on 2006-10-31, released 2007-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.155
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endonuclease 4
    Species: Escherichia coli [TaxId:562]
    Gene: nfo
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6C1 (0-End)
      • engineered (260)
    Domains in SCOPe 2.07: d2nqha_
  • Heterogens: ZN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nqhA (A:)
    mkyigahvsaagglanaairaaeidatafalftknqrqwraaplttqtidefkaacekyh
    ytsaqilphdsylinlghpvtealeksrdafidemqrceqlglsllnfhpgshlmqisee
    dclariaesinialdktqgvtavientagqgsnlgfkfehlaaiidgvedksrvgvcidt
    chafaagydlrtpaecektfadfartvgfkylrgmhlndakstfgsrvdrhhslgegnig
    hdafrwimqddrfdgiplilqtinpdiwaeeiawlkaqqtekava
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nqhA (A:)
    mkyigahvsaagglanaairaaeidatafalftknqrqwraaplttqtidefkaacekyh
    ytsaqilphdsylinlghpvtealeksrdafidemqrceqlglsllnfhpgshlmqisee
    dclariaesinialdktqgvtavientagqgsnlgfkfehlaaiidgvedksrvgvcidt
    chafaagydlrtpaecektfadfartvgfkylrgmhlndakstfgsrvdrhhslgegnig
    hdafrwimqddrfdgiplilqtinpdiwaeeiawlkaqq