PDB entry 2nq3

View 2nq3 on RCSB PDB site
Description: Crystal structure of the C2 Domain of Human Itchy Homolog E3 Ubiquitin Protein Ligase
Class: ligase
Keywords: c2 domain, ligase, ubl conjugation pathway, structural genomics consortium, sgc
Deposited on 2006-10-30, released 2006-11-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.164
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Itchy homolog E3 ubiquitin protein ligase
    Species: Homo sapiens [TaxId:9606]
    Gene: ITCH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2nq3a1
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2nq3A (A:)
mhhhhhhssgrenlyfqgmsdsgsqlgsmgsltmksqlqitvisaklkenkknwfgpspy
vevtvdgqskktekcnntnspkwkqpltvivtpvsklhfrvwshqtlksdvllgtaaldi
yetlksnnmkleevvvtlqlggdkeptetigdlsicldglqlesevvtngett

    Sequence, based on observed residues (ATOM records): (download) 
    >2nq3A (A:)
sltmksqlqitvisaklkenkwfgpspyvevtvdgqskktekcnntnspkwkqpltvivt
pvsklhfrvwshqtlksdvllgtaaldiyetlksnnmkleevvvtlqlggdkeptetigd
lsicldglqle