PDB entry 2nps

View 2nps on RCSB PDB site
Description: Crystal Structure of the Early Endosomal SNARE Complex
Class: transport protein
Keywords: Vesicle fusion, SNARE complex, early endosomal SNARE complex, syntaxin 6, syntaxin 13, Vti1a, VAMP4, TRANSPORT PROTEIN
Deposited on 2006-10-30, released 2006-12-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.247
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vesicle-associated membrane protein 4
    Species: Mus musculus [TaxId:10090]
    Gene: Vamp4_predicted
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2npsa_
  • Chain 'B':
    Compound: Syntaxin 13
    Species: Rattus norvegicus [TaxId:10116]
    Gene: syntaxin 13
    Database cross-references and differences (RAF-indexed):
    • Uniprot O70319 (3-End)
      • cloning artifact (0-2)
    Domains in SCOPe 2.05: d2npsb_
  • Chain 'C':
    Compound: Vesicle transport through interaction with t-SNAREs homolog 1A
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Vti1a
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JI51 (3-End)
      • cloning artifact (0-2)
  • Chain 'D':
    Compound: Syntaxin-6
    Species: Homo sapiens [TaxId:9606]
    Gene: STX6
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2npsA (A:)
gsmgprndkikhvqnqvdevidvmqenitkviergerldelqdkseslsdnatafsnrsk
qlrrqmwwrgckik

    Sequence, based on observed residues (ATOM records): (download) 
    >2npsA (A:)
rndkikhvqnqvdevidvmqenitkviergerldelqdkseslsdnatafsnrskqlrrq
mww

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2npsB (B:)
gsmretaiqqleadildvnqifkdlammihdqgdlidsieanvessevhverasdqlqra
ayyqkksrkkm

    Sequence, based on observed residues (ATOM records): (download) 
    >2npsB (B:)
gsmretaiqqleadildvnqifkdlammihdqgdlidsieanvessevhverasdqlqra
ayyqkksr

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.