PDB entry 2npq

View 2npq on RCSB PDB site
Description: A Novel Lipid Binding Site in the p38 alpha MAP Kinase
Class: transferase
Keywords: lipid binding site, kinase, protein-lipid complex, TRANSFERASE
Deposited on 2006-10-29, released 2007-10-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.205
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2npqa_
  • Heterogens: BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2npqA (A:)
    mahhhhhhsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavk
    klsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadl
    nnivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglar
    htddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlk
    lilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvlds
    dkritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppl
    dqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2npqA (A:)
    erptfyrqelnktiwevperyqnlspvgsgsvcaafdtktglrvavkklsrpfqsiihak
    rtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnqkltddhvqfli
    yqilrglkyihsadiihrdlkpsnlavnedcelkildfatrwyrapeimlnwmhynqtvd
    iwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltqm
    pkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydq
    sfesrdllidewksltydevisfvpp