PDB entry 2np8

View 2np8 on RCSB PDB site
Description: Structural Basis for the Inhibition of Aurora A Kinase by a Novel Class of High Affinity Disubstituted Pyrimidine Inhibitors
Class: Transferase
Keywords: Aurora A kinase, AIK, aurora 2 kinase, kinase, kinase inhibitor, Transferase
Deposited on 2006-10-26, released 2006-12-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.246
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: AIK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2np8a_
  • Heterogens: SO4, CC3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2np8A (A:)
    gamgskrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlr
    reveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyite
    lanalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppe
    miegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardl
    isrllkhnpsqrpmlrevlehpwitansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2np8A (A:)
    qwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiqs
    hlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsy
    chskrvihrdikpenlllgsagelkiadfgwsvhapssrtldylppemiegrmhdekvdl
    wslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrp
    mlrevlehpwitanss