PDB entry 2np0

View 2np0 on RCSB PDB site
Description: Crystal structure of the Botulinum neurotoxin type B complexed with synaptotagamin-II ectodomain
Class: hydrolase
Keywords: botulinum, neurotoxin, synaptotagamin, receptor, hydrolase
Deposited on 2006-10-26, released 2006-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: 0.188
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: botulinum neurotoxin type b
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2np0a1, d2np0a2, d2np0a3, d2np0a4
  • Chain 'B':
    Compound: Synaptotagmin-2
    Species: Mus musculus [TaxId:10090]
    Gene: Syt2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2np0A (A:)
    pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
    ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
    rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
    asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
    ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
    rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
    aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
    eeiskehlavykiqmcksvkapgicidvdnedlffiadknsfsddlsknerieyntqsny
    iendfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftdentifqyl
    ysqtfpldirdisltssfddallfsnkvysffsmdyiktankvveaglfagwvkqivndf
    vieanksntmdkiadislivpyiglalnvgnetakgnfenafeiagasillefipellip
    vvgafllesyidnknkiiktidnaltkrnekwsdmyglivaqwlstvntqfytikegmyk
    alnyqaqaleeiikyryniysekeksninidfndinsklneginqaidninnfingcsvs
    ylmkkmiplaveklldfdntlkknllnyidenklyligsaeyekskvnkylktimpfdls
    iytndtiliemfnkynseilnniilnlrykdnnlidlsgygakvevydgvelndknqfkl
    tssanskirvtqnqniifnsvfldfsvsfwiripkykndgiqnyihneytiincmknnsg
    wkisirgnriiwtlidingktksvffeynirediseyinrwffvtitnnlnnakiyingk
    lesntdikdireviangeiifkldgdidrtqfiwmkyfsifntelsqsnieerykiqsys
    eylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdlyi
    gekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisds
    defyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfcisk
    wylkevkrkpynlklgcnwqfipkdegwte
    

    Sequence, based on observed residues (ATOM records): (download)
    >2np0A (A:)
    pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
    ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
    rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
    asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
    ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
    rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
    aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
    eeiskehlavykiqmcksvkpgicidvdnedlffiadknsfsddlsknerieyntqsnyi
    endfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftdentifqyly
    sqtfpldirdisltssfddallfsnkvysffsmdyiktankvveaglfagwvkqivndfv
    ieanksntmdkiadislivpyiglalnvgnetakgnfenafeiagasillefipellipv
    vgafllesyidnknkiiktidnaltkrnekwsdmyglivaqwlstvntqfytikegmyka
    lnyqaqaleeiikyryniysekeksninidfndinsklneginqaidninnfingcsvsy
    lmkkmiplaveklldfdntlkknllnyidenklyligsaeyekskvnkylktimpfdlsi
    ytndtiliemfnkynseilnniilnlrykdnnlidlsgygakvevydgvelndknqfklt
    ssanskirvtqnqniifnsvfldfsvsfwiripkykndgiqnyihneytiincmknnsgw
    kisirgnriiwtlidingktksvffeynirediseyinrwffvtitnnlnnakiyingkl
    esntdikdireviangeiifkldgdidrtqfiwmkyfsifntelsqsnieerykiqsyse
    ylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdlyig
    ekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisdsd
    efyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfciskw
    ylkevkrkpynlklgcnwqfipkdegwte
    

  • Chain 'B':
    No sequence available.