PDB entry 2nox

View 2nox on RCSB PDB site
Description: Crystal structure of tryptophan 2,3-dioxygenase from Ralstonia metallidurans
Class: Oxidoreductase
Keywords: helical bundle, heme protein, Oxidoreductase
Deposited on 2006-10-26, released 2006-12-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophan 2,3-dioxygenase
    Species: Cupriavidus metallidurans [TaxId:119219]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2noxa_
  • Chain 'B':
    Compound: Tryptophan 2,3-dioxygenase
    Species: Cupriavidus metallidurans [TaxId:119219]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2noxb_
  • Chain 'C':
    Compound: Tryptophan 2,3-dioxygenase
    Species: Cupriavidus metallidurans [TaxId:119219]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2noxc_
  • Chain 'D':
    Compound: Tryptophan 2,3-dioxygenase
    Species: Cupriavidus metallidurans [TaxId:119219]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2noxd_
  • Chain 'E':
    Compound: Tryptophan 2,3-dioxygenase
    Species: Cupriavidus metallidurans [TaxId:119219]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2noxe_
  • Chain 'F':
    Compound: Tryptophan 2,3-dioxygenase
    Species: Cupriavidus metallidurans [TaxId:119219]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2noxf_
  • Chain 'G':
    Compound: Tryptophan 2,3-dioxygenase
    Species: Cupriavidus metallidurans [TaxId:119219]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2noxg_
  • Chain 'H':
    Compound: Tryptophan 2,3-dioxygenase
    Species: Cupriavidus metallidurans [TaxId:119219]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2noxh_
  • Chain 'I':
    Compound: Tryptophan 2,3-dioxygenase
    Species: Cupriavidus metallidurans [TaxId:119219]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2noxi_
  • Chain 'J':
    Compound: Tryptophan 2,3-dioxygenase
    Species: Cupriavidus metallidurans [TaxId:119219]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2noxj_
  • Chain 'K':
    Compound: Tryptophan 2,3-dioxygenase
    Species: Cupriavidus metallidurans [TaxId:119219]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2noxk_
  • Chain 'L':
    Compound: Tryptophan 2,3-dioxygenase
    Species: Cupriavidus metallidurans [TaxId:119219]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2noxl_
  • Chain 'M':
    Compound: Tryptophan 2,3-dioxygenase
    Species: Cupriavidus metallidurans [TaxId:119219]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2noxm_
  • Chain 'N':
    Compound: Tryptophan 2,3-dioxygenase
    Species: Cupriavidus metallidurans [TaxId:119219]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2noxn_
  • Chain 'O':
    Compound: Tryptophan 2,3-dioxygenase
    Species: Cupriavidus metallidurans [TaxId:119219]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2noxo_
  • Chain 'P':
    Compound: Tryptophan 2,3-dioxygenase
    Species: Cupriavidus metallidurans [TaxId:119219]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2noxp_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2noxA (A:)
    dggdsgdtgngwhgaqmdfardmsygdylgldqilsaqhplspdhnemlfivqhqttelw
    mklmlhelraardgvksdqlqpafkmlarvsrimdqlvqawnvlatmtppeysamrpylg
    assgfqsyqyreiefilgnknaamlrphahrpehlelvetalhtpsmydeairlmarrgf
    qidpevverdwtqptqynasveaawlevyrnpsahwelyelgekfvdledafrqwrfrhv
    ttvervigfkrgtggtegvsylrrmldvvlfpelwklrtdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2noxA (A:)
    rdmsygdylgldqilsaqhplspdhnemlfivqhqttelwmklmlhelraardgvksdql
    qpafkmlarvsrimdqlvqawnvlatmtppeysamrpylgassgfqsyqyreiefilgnk
    naamlrphahrpehlelvetalhtpsmydeairlmarrgfqidpevverdwtqptqynas
    veaawlevyrnpsahwelyelgekfvdledafrqwrfrhvttvervigfkrgtggtegvs
    ylrrmldvvlfpelwklrtdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2noxB (B:)
    dggdsgdtgngwhgaqmdfardmsygdylgldqilsaqhplspdhnemlfivqhqttelw
    mklmlhelraardgvksdqlqpafkmlarvsrimdqlvqawnvlatmtppeysamrpylg
    assgfqsyqyreiefilgnknaamlrphahrpehlelvetalhtpsmydeairlmarrgf
    qidpevverdwtqptqynasveaawlevyrnpsahwelyelgekfvdledafrqwrfrhv
    ttvervigfkrgtggtegvsylrrmldvvlfpelwklrtdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2noxB (B:)
    whgaqmdfardmsygdylgldqilsaqhplspdhnemlfivqhqttelwmklmlhelraa
    rdgvksdqlqpafkmlarvsrimdqlvqawnvlatmtppeysamrpylgassgfqsyqyr
    eiefilgnknaamlrphahrpehlelvetalhtpsmydeairlmarrgfqidpevverdw
    tqptqynasveaawlevyrnpsahwelyelgekfvdledafrqwrfrhvttvervigfkr
    gegvsylrrmldvvlfpelwklrtdl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2noxC (C:)
    dggdsgdtgngwhgaqmdfardmsygdylgldqilsaqhplspdhnemlfivqhqttelw
    mklmlhelraardgvksdqlqpafkmlarvsrimdqlvqawnvlatmtppeysamrpylg
    assgfqsyqyreiefilgnknaamlrphahrpehlelvetalhtpsmydeairlmarrgf
    qidpevverdwtqptqynasveaawlevyrnpsahwelyelgekfvdledafrqwrfrhv
    ttvervigfkrgtggtegvsylrrmldvvlfpelwklrtdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2noxC (C:)
    dmsygdylgldqilsaqhplspdhnemlfivqhqttelwmklmlhelraardgvksdqlq
    pafkmlarvsrimdqlvqawnvlatmtppeysamrpylgassgfqsyqyreiefilgnkn
    aamlrphahrpehlelvetalhtpsmydeairlmarrgfqidpevverdwtqptqynasv
    eaawlevyrnpsahwelyelgekfvdledafrqwrfrhvttvervigfgtegvsylrrml
    dvvlfpelwklrtdl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2noxD (D:)
    dggdsgdtgngwhgaqmdfardmsygdylgldqilsaqhplspdhnemlfivqhqttelw
    mklmlhelraardgvksdqlqpafkmlarvsrimdqlvqawnvlatmtppeysamrpylg
    assgfqsyqyreiefilgnknaamlrphahrpehlelvetalhtpsmydeairlmarrgf
    qidpevverdwtqptqynasveaawlevyrnpsahwelyelgekfvdledafrqwrfrhv
    ttvervigfkrgtggtegvsylrrmldvvlfpelwklrtdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2noxD (D:)
    msygdylgldqilsaqhplspdhnemlfivqhqttelwmklmlhelraardgvksdqlqp
    afkmlarvsrimdqlvqawnvlatmtppeysamrpylgassgfqsyqyreiefilgnkna
    amlrphahrpehlelvetalhtpsmydeairlmarrgfqidpevverdwtqptqynasve
    aawlevyrnpsahwelyelgekfvdledafrqwrfrhvttvervigfkrgtggtegvsyl
    rrmldvvlfpelwklrtdl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2noxE (E:)
    dggdsgdtgngwhgaqmdfardmsygdylgldqilsaqhplspdhnemlfivqhqttelw
    mklmlhelraardgvksdqlqpafkmlarvsrimdqlvqawnvlatmtppeysamrpylg
    assgfqsyqyreiefilgnknaamlrphahrpehlelvetalhtpsmydeairlmarrgf
    qidpevverdwtqptqynasveaawlevyrnpsahwelyelgekfvdledafrqwrfrhv
    ttvervigfkrgtggtegvsylrrmldvvlfpelwklrtdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2noxE (E:)
    rdmsygdylgldqilsaqhplspdhnemlfivqhqttelwmklmlhelraardgvksdql
    qpafkmlarvsrimdqlvqawnvlatmtppeysamrpylgassgfqsyqyreiefilgnk
    naamlrphahrpehlelvetalhtpsmydeairlmarrgfqidpevverdwtqptqynas
    veaawlevyrnpsahwelyelgekfvdledafrqwrfrhvttvervigfkregvsylrrm
    ldvvlfpelwklrtdl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2noxF (F:)
    dggdsgdtgngwhgaqmdfardmsygdylgldqilsaqhplspdhnemlfivqhqttelw
    mklmlhelraardgvksdqlqpafkmlarvsrimdqlvqawnvlatmtppeysamrpylg
    assgfqsyqyreiefilgnknaamlrphahrpehlelvetalhtpsmydeairlmarrgf
    qidpevverdwtqptqynasveaawlevyrnpsahwelyelgekfvdledafrqwrfrhv
    ttvervigfkrgtggtegvsylrrmldvvlfpelwklrtdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2noxF (F:)
    mdfardmsygdylgldqilsaqhplspdhnemlfivqhqttelwmklmlhelraardgvk
    sdqlqpafkmlarvsrimdqlvqawnvlatmtppeysamrpylgassgfqsyqyreiefi
    lgnknaamlrphahrpehlelvetalhtpsmydeairlmarrgfqidpevverdwtqptq
    ynasveaawlevyrnpsahwelyelgekfvdledafrqwrfrhvttvervigfkregvsy
    lrrmldvvlfpelwklrtdl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2noxG (G:)
    dggdsgdtgngwhgaqmdfardmsygdylgldqilsaqhplspdhnemlfivqhqttelw
    mklmlhelraardgvksdqlqpafkmlarvsrimdqlvqawnvlatmtppeysamrpylg
    assgfqsyqyreiefilgnknaamlrphahrpehlelvetalhtpsmydeairlmarrgf
    qidpevverdwtqptqynasveaawlevyrnpsahwelyelgekfvdledafrqwrfrhv
    ttvervigfkrgtggtegvsylrrmldvvlfpelwklrtdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2noxG (G:)
    dmsygdylgldqilsaqhplspdhnemlfivqhqttelwmklmlhelraardgvksdqlq
    pafkmlarvsrimdqlvqawnvlatmtppeysamrpylgassgfqsyqyreiefilgnkn
    aamlrphahrpehlelvetalhtpsmydeairlmarrgfqidpevverdwtqptqynasv
    eaawlevyrnpsahwelyelgekfvdledafrqwrfrhvttvervigfkrtggtegvsyl
    rrmldvvlfpelwklrtdl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2noxH (H:)
    dggdsgdtgngwhgaqmdfardmsygdylgldqilsaqhplspdhnemlfivqhqttelw
    mklmlhelraardgvksdqlqpafkmlarvsrimdqlvqawnvlatmtppeysamrpylg
    assgfqsyqyreiefilgnknaamlrphahrpehlelvetalhtpsmydeairlmarrgf
    qidpevverdwtqptqynasveaawlevyrnpsahwelyelgekfvdledafrqwrfrhv
    ttvervigfkrgtggtegvsylrrmldvvlfpelwklrtdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2noxH (H:)
    msygdylgldqilsaqhplspdhnemlfivqhqttelwmklmlhelraardgvksdqlqp
    afkmlarvsrimdqlvqawnvlatmtppeysamrpylgassgfqsyqyreiefilgnkna
    amlrphahrpehlelvetalhtpsmydeairlmarrgfqidpevverdwtqptqynasve
    aawlevyrnpsahwelyelgekfvdledafrqwrfrhvttvervigfkrgtggtegvsyl
    rrmldvvlfpelwklrtdl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2noxI (I:)
    dggdsgdtgngwhgaqmdfardmsygdylgldqilsaqhplspdhnemlfivqhqttelw
    mklmlhelraardgvksdqlqpafkmlarvsrimdqlvqawnvlatmtppeysamrpylg
    assgfqsyqyreiefilgnknaamlrphahrpehlelvetalhtpsmydeairlmarrgf
    qidpevverdwtqptqynasveaawlevyrnpsahwelyelgekfvdledafrqwrfrhv
    ttvervigfkrgtggtegvsylrrmldvvlfpelwklrtdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2noxI (I:)
    msygdylgldqilsaqhplspdhnemlfivqhqttelwmklmlhelraardgvksdqlqp
    afkmlarvsrimdqlvqawnvlatmtppeysamrpylgassgfqsyqyreiefilgnkna
    amlrphahrpehlelvetalhtpsmydeairlmarrgfqidpevverdwtqptqynasve
    aawlevyrnpsahwelyelgekfvdledafrqwrfrhvttvervigfkrgtggtegvsyl
    rrmldvvlfpelwklrtdl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2noxJ (J:)
    dggdsgdtgngwhgaqmdfardmsygdylgldqilsaqhplspdhnemlfivqhqttelw
    mklmlhelraardgvksdqlqpafkmlarvsrimdqlvqawnvlatmtppeysamrpylg
    assgfqsyqyreiefilgnknaamlrphahrpehlelvetalhtpsmydeairlmarrgf
    qidpevverdwtqptqynasveaawlevyrnpsahwelyelgekfvdledafrqwrfrhv
    ttvervigfkrgtggtegvsylrrmldvvlfpelwklrtdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2noxJ (J:)
    rdmsygdylgldqilsaqhplspdhnemlfivqhqttelwmklmlhelraardgvksdql
    qpafkmlarvsrimdqlvqawnvlatmtppeysamrpylgassgfqsyqyreiefilgnk
    naamlrphahrpehlelvetalhtpsmydeairlmarrgfqidpevverdwtqptqynas
    veaawlevyrnpsahwelyelgekfvdledafrqwrfrhvttvervigfkgtegvsylrr
    mldvvlfpelwklrtdl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2noxK (K:)
    dggdsgdtgngwhgaqmdfardmsygdylgldqilsaqhplspdhnemlfivqhqttelw
    mklmlhelraardgvksdqlqpafkmlarvsrimdqlvqawnvlatmtppeysamrpylg
    assgfqsyqyreiefilgnknaamlrphahrpehlelvetalhtpsmydeairlmarrgf
    qidpevverdwtqptqynasveaawlevyrnpsahwelyelgekfvdledafrqwrfrhv
    ttvervigfkrgtggtegvsylrrmldvvlfpelwklrtdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2noxK (K:)
    rdmsygdylgldqilsaqhplspdhnemlfivqhqttelwmklmlhelraardgvksdql
    qpafkmlarvsrimdqlvqawnvlatmtppeysamrpylgassgfqsyqyreiefilgnk
    naamlrphahrpehlelvetalhtpsmydeairlmarrgfqidpevverdwtqptqynas
    veaawlevyrnpsahwelyelgekfvdledafrqwrfrhvttvervigftegvsylrrml
    dvvlfpelwklrtdl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2noxL (L:)
    dggdsgdtgngwhgaqmdfardmsygdylgldqilsaqhplspdhnemlfivqhqttelw
    mklmlhelraardgvksdqlqpafkmlarvsrimdqlvqawnvlatmtppeysamrpylg
    assgfqsyqyreiefilgnknaamlrphahrpehlelvetalhtpsmydeairlmarrgf
    qidpevverdwtqptqynasveaawlevyrnpsahwelyelgekfvdledafrqwrfrhv
    ttvervigfkrgtggtegvsylrrmldvvlfpelwklrtdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2noxL (L:)
    dmsygdylgldqilsaqhplspdhnemlfivqhqttelwmklmlhelraardgvksdqlq
    pafkmlarvsrimdqlvqawnvlatmtppeysamrpylgassgfqsyqyreiefilgnkn
    aamlrphahrpehlelvetalhtpsmydeairlmarrgfqidpevverdwtqptqynasv
    eaawlevyrnpsahwelyelgekfvdledafrqwrfrhvttvervigfkrgtggtegvsy
    lrrmldvvlfpelwklrtdl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2noxM (M:)
    dggdsgdtgngwhgaqmdfardmsygdylgldqilsaqhplspdhnemlfivqhqttelw
    mklmlhelraardgvksdqlqpafkmlarvsrimdqlvqawnvlatmtppeysamrpylg
    assgfqsyqyreiefilgnknaamlrphahrpehlelvetalhtpsmydeairlmarrgf
    qidpevverdwtqptqynasveaawlevyrnpsahwelyelgekfvdledafrqwrfrhv
    ttvervigfkrgtggtegvsylrrmldvvlfpelwklrtdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2noxM (M:)
    dmsygdylgldqilsaqhplspdhnemlfivqhqttelwmklmlhelraardgvksdqlq
    pafkmlarvsrimdqlvqawnvlatmtppeysamrpylgassgfqsyqyreiefilgnkn
    aamlrphahrpehlelvetalhtpsmydeairlmarrgfqidpevverdwtqptqynasv
    eaawlevyrnpsahwelyelgekfvdledafrqwrfrhvttvervigfkregvsylrrml
    dvvlfpelwklrtdl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2noxN (N:)
    dggdsgdtgngwhgaqmdfardmsygdylgldqilsaqhplspdhnemlfivqhqttelw
    mklmlhelraardgvksdqlqpafkmlarvsrimdqlvqawnvlatmtppeysamrpylg
    assgfqsyqyreiefilgnknaamlrphahrpehlelvetalhtpsmydeairlmarrgf
    qidpevverdwtqptqynasveaawlevyrnpsahwelyelgekfvdledafrqwrfrhv
    ttvervigfkrgtggtegvsylrrmldvvlfpelwklrtdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2noxN (N:)
    dmsygdylgldqilsaqhplspdhnemlfivqhqttelwmklmlhelraardgvksdqlq
    pafkmlarvsrimdqlvqawnvlatmtppeysamrpylgassgfqsyqyreiefilgnkn
    aamlrphahrpehlelvetalhtpsmydeairlmarrgfqidpevverdwtqptqynasv
    eaawlevyrnpsahwelyelgekfvdledafrqwrfrhvttvervigfkrgtggtegvsy
    lrrmldvvlfpelwklrtdl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2noxO (O:)
    dggdsgdtgngwhgaqmdfardmsygdylgldqilsaqhplspdhnemlfivqhqttelw
    mklmlhelraardgvksdqlqpafkmlarvsrimdqlvqawnvlatmtppeysamrpylg
    assgfqsyqyreiefilgnknaamlrphahrpehlelvetalhtpsmydeairlmarrgf
    qidpevverdwtqptqynasveaawlevyrnpsahwelyelgekfvdledafrqwrfrhv
    ttvervigfkrgtggtegvsylrrmldvvlfpelwklrtdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2noxO (O:)
    rdmsygdylgldqilsaqhplspdhnemlfivqhqttelwmklmlhelraardgvksdql
    qpafkmlarvsrimdqlvqawnvlatmtppeysamrpylgassgfqsyqyreiefilgnk
    naamlrphahrpehlelvetalhtpsmydeairlmarrgfqidpevverdwtqptqynas
    veaawlevyrnpsahwelyelgekfvdledafrqwrfrhvttvervigfkgtegvsylrr
    mldvvlfpelwklrtdl
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2noxP (P:)
    dggdsgdtgngwhgaqmdfardmsygdylgldqilsaqhplspdhnemlfivqhqttelw
    mklmlhelraardgvksdqlqpafkmlarvsrimdqlvqawnvlatmtppeysamrpylg
    assgfqsyqyreiefilgnknaamlrphahrpehlelvetalhtpsmydeairlmarrgf
    qidpevverdwtqptqynasveaawlevyrnpsahwelyelgekfvdledafrqwrfrhv
    ttvervigfkrgtggtegvsylrrmldvvlfpelwklrtdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2noxP (P:)
    msygdylgldqilsaqhplspdhnemlfivqhqttelwmklmlhelraardgvksdqlqp
    afkmlarvsrimdqlvqawnvlatmtppeysamrpylgassgfqsyqyreiefilgnkna
    amlrphahrpehlelvetalhtpsmydeairlmarrgfqidpevverdwtqptqynasve
    aawlevyrnpsahwelyelgekfvdledafrqwrfrhvttvervigfkrgtggtegvsyl
    rrmldvvlfpelwklrtdl