PDB entry 2not

View 2not on RCSB PDB site
Description: notechis ii-5, neurotoxic phospholipase a2 from notechis scutatus scutatus
Deposited on 1997-03-03, released 1997-06-16
The last revision prior to the SCOP 1.71 freeze date was dated 1997-06-16, with a file datestamp of 1997-06-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.219
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d2nota_
  • Chain 'B':
    Domains in SCOP 1.71: d2notb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2notA (A:)
    nlvqfsyliqcanhgrrptrhymdygcycgwggsgtpvdeldrcckihddcysdaekkgc
    spkmsaydyycgengpycrnikkkclrfvcdcdveaafcfakapynnanwnidtkkrcq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2notB (B:)
    nlvqfsyliqcanhgrrptrhymdygcycgwggsgtpvdeldrcckihddcysdaekkgc
    spkmsaydyycgengpycrnikkkclrfvcdcdveaafcfakapynnanwnidtkkrcq