PDB entry 2nol

View 2nol on RCSB PDB site
Description: Structure of catalytically inactive human 8-oxoguanine glycosylase distal crosslink to oxoG DNA
Class: Hydrolase, Lyase/DNA
Keywords: N-glycosylase/DNA lyase, DNA repair, 8-oxoguanine, Hydrolase, Lyase/DNA COMPLEX
Deposited on 2006-10-25, released 2006-11-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.206
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-glycosylase/DNA lyase
    Species: Homo sapiens [TaxId:9606]
    Gene: OGG1, MMH, MUTM, OGH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15527 (9-End)
      • cloning artifact (6-8)
      • engineered (246)
      • engineered (289)
    Domains in SCOPe 2.06: d2nola1, d2nola2, d2nola3
  • Chain 'B':
    Compound: 5'-d(*gp*gp*tp*ap*gp*ap*cp*cp*tp*gp*gp*ap*cp*gp*c)-3'
  • Chain 'C':
    Compound: 5'-d(*gp*cp*gp*tp*cp*cp*ap*(g42)p*gp*tp*cp*tp*ap*cp*c)-3'
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nolA (A:)
    amadigsefghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladq
    vwtltqteeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqe
    vaqkfqgvrllrqdpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfp
    slqalagpeveahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalci
    lpgvgtqvadciclmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpcpqtnkelgnf
    frslwgpyagwaqavlfsadlrqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nolA (A:)
    sefghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
    teeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
    llrqdpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpe
    veahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtqva
    dciclmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpcpqtnkelgnffrslwgpya
    gwaqavlfsadlrq
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.