PDB entry 2nog

View 2nog on RCSB PDB site
Description: SANT Domain Structure of Xenopus Remodeling Factor ISWI
Class: DNA binding protein
Keywords: SANT domain; histone-tail binding module; chromatin binding; helix-turn-helix, DNA BINDING PROTEIN
Deposited on 2006-10-25, released 2007-09-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: iswi protein
    Species: Xenopus laevis [TaxId:8355]
    Gene: ISWI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DFM0
      • see remark 999 (72)
    Domains in SCOPe 2.08: d2noga1
  • Chain 'B':
    Compound: iswi protein
    Species: Xenopus laevis [TaxId:8355]
    Gene: ISWI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DFM0
      • see remark 999 (72)
    Domains in SCOPe 2.08: d2nogb1, d2nogb2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nogA (A:)
    mvsepkvpkaprppkqpnvqdfqffpprlfellekeilyyrktigykvprnpdlpnsaqv
    qkeeqlkideaeplndeeleekeklltqgftnwnkrdfnqfikanekwgrddieniarev
    egktpeevieysavfwercnelqdiektmaqiergeariqrrisilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nogA (A:)
    epkvpkaprppkqpnvqdfqffpprlfellekeilyyrktigykvprnpdlpnsaqvqke
    eqlkideaeplndeeleekeklltqgftnwnkrdfnqfikanekwgrddieniarevegk
    tpeevieysavfwercnelqdiektmaqiergeariq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nogB (B:)
    mvsepkvpkaprppkqpnvqdfqffpprlfellekeilyyrktigykvprnpdlpnsaqv
    qkeeqlkideaeplndeeleekeklltqgftnwnkrdfnqfikanekwgrddieniarev
    egktpeevieysavfwercnelqdiektmaqiergeariqrrisilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nogB (B:)
    epkvpkaprppkqpnvqdfqffpprlfellekeilyyrktigykvprnpdlpnsaqvqke
    eqlkideaeplndeeleekeklltqgftnwnkrdfnqfikanekwgrddieniarevegk
    tpeevieysavfwercnelqdiektmaqiergeari