PDB entry 2no5

View 2no5 on RCSB PDB site
Description: Crystal Structure analysis of a Dehalogenase with intermediate complex
Class: Hydrolase
Keywords: Haloacid dehalogenase, Dehalogenase, HAD Superfamily, Intermediate structure, Hydrolase
Deposited on 2006-10-24, released 2007-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.199
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (S)-2-haloacid dehalogenase IVA
    Species: Burkholderia cepacia [TaxId:292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51645 (10-End)
      • expression tag (9)
      • modified residue (19)
    Domains in SCOPe 2.07: d2no5a1, d2no5a2
  • Chain 'B':
    Compound: (S)-2-haloacid dehalogenase IVA
    Species: Burkholderia cepacia [TaxId:292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51645 (10-End)
      • expression tag (9)
      • modified residue (19)
    Domains in SCOPe 2.07: d2no5b1, d2no5b2
  • Heterogens: CL, SO4, CNR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2no5A (A:)
    mdykddddklvdslracvfdaygtlldvhsavmrnadevgasaealsmlwrqrqleyswt
    rtlmhqyadfwqltdealtfalrtyhledrkglkdrlmsaykelsaypdaaetleklksa
    gyivailsngndemlqaalkaskldrvldsclsaddlkiykpdpriyqfacdrlgvnpne
    vcfvssnawdlggagkfgfntvrinrqgnppeyefaplkhqvnslselwpllaknvtkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2no5A (A:)
    lvdslracvfdaygtlldvhsavmrnadevgasaealsmlwrqrqleyswtrtlmhqyad
    fwqltdealtfalrtyhledrkglkdrlmsaykelsaypdaaetleklksagyivailsn
    gndemlqaalkaskldrvldsclsaddlkiykpdpriyqfacdrlgvnpnevcfvssnaw
    dlggagkfgfntvrinrqgnppeyefaplkhqvnslselwpllak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2no5B (B:)
    mdykddddklvdslracvfdaygtlldvhsavmrnadevgasaealsmlwrqrqleyswt
    rtlmhqyadfwqltdealtfalrtyhledrkglkdrlmsaykelsaypdaaetleklksa
    gyivailsngndemlqaalkaskldrvldsclsaddlkiykpdpriyqfacdrlgvnpne
    vcfvssnawdlggagkfgfntvrinrqgnppeyefaplkhqvnslselwpllaknvtkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2no5B (B:)
    lvdslracvfdaygtlldvhsavmrnadevgasaealsmlwrqrqleyswtrtlmhqyad
    fwqltdealtfalrtyhledrkglkdrlmsaykelsaypdaaetleklksagyivailsn
    gndemlqaalkaskldrvldsclsaddlkiykpdpriyqfacdrlgvnpnevcfvssnaw
    dlggagkfgfntvrinrqgnppeyefaplkhqvnslselwpllakn