PDB entry 2no4

View 2no4 on RCSB PDB site
Description: Crystal Structure analysis of a Dehalogenase
Class: hydrolase
Keywords: Haloacid Dehalogenase, HAD Superfamily, Rossmann fold, Hydrolase
Deposited on 2006-10-24, released 2007-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (S)-2-haloacid dehalogenase IVA
    Species: Burkholderia cepacia [TaxId:292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51645 (10-End)
      • expression tag (9)
    Domains in SCOPe 2.07: d2no4a1, d2no4a2
  • Chain 'B':
    Compound: (S)-2-haloacid dehalogenase IVA
    Species: Burkholderia cepacia [TaxId:292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51645 (10-End)
      • expression tag (9)
    Domains in SCOPe 2.07: d2no4b1, d2no4b2
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2no4A (A:)
    mdykddddklvdslracvfdaygtlldvhsavmrnadevgasaealsmlwrqrqleyswt
    rtlmhqyadfwqltdealtfalrtyhledrkglkdrlmsaykelsaypdaaetleklksa
    gyivailsngndemlqaalkaskldrvldsclsaddlkiykpdpriyqfacdrlgvnpne
    vcfvssnawdlggagkfgfntvrinrqgnppeyefaplkhqvnslselwpllaknvtkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2no4A (A:)
    lvdslracvfdaygtlldvhsavmrnadevgasaealsmlwrqrqleyswtrtlmhqyad
    fwqltdealtfalrtyhledrkglkdrlmsaykelsaypdaaetleklksagyivailsn
    gndemlqaalkaskldrvldsclsaddlkiykpdpriyqfacdrlgvnpnevcfvssnaw
    dlggagkfgfntvrinrqgnppeyefaplkhqvnslselwpllak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2no4B (B:)
    mdykddddklvdslracvfdaygtlldvhsavmrnadevgasaealsmlwrqrqleyswt
    rtlmhqyadfwqltdealtfalrtyhledrkglkdrlmsaykelsaypdaaetleklksa
    gyivailsngndemlqaalkaskldrvldsclsaddlkiykpdpriyqfacdrlgvnpne
    vcfvssnawdlggagkfgfntvrinrqgnppeyefaplkhqvnslselwpllaknvtkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2no4B (B:)
    lvdslracvfdaygtlldvhsavmrnadevgasaealsmlwrqrqleyswtrtlmhqyad
    fwqltdealtfalrtyhledrkglkdrlmsaykelsaypdaaetleklksagyivailsn
    gndemlqaalkaskldrvldsclsaddlkiykpdpriyqfacdrlgvnpnevcfvssnaw
    dlggagkfgfntvrinrqgnppeyefaplkhqvnslselwpllakn