PDB entry 2nnu

View 2nnu on RCSB PDB site
Description: Crystal Structure of the Papillomavirus DNA Tethering Complex E2:Brd4
Class: transcription
Keywords: Protein-peptide complex, Helical peptide, three helix bundle, amphipathic helix, TRANSCRIPTION
Deposited on 2006-10-24, released 2007-01-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.201
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein E2
    Species: Human papillomavirus type 16 [TaxId:333760]
    Gene: E2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03120 (4-End)
      • cloning artifact (3)
    Domains in SCOPe 2.08: d2nnua2, d2nnua3
  • Chain 'B':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, HUNK1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nnuA (A:)
    gsgsmetlcqrlnvcqdkilthyendstdlrdhidywkhmrlecaiyykaremgfkhinh
    qvvptlavsknkalqaielqltletiynsqysnekwtlqdvslevyltaptgcikkhgyt
    vevqfdgdicntmhytnwthiyiceeasvtvvegqvdyyglyyvhegirtyfvqfkddae
    kysknkvwevhaggqvilcptsvfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nnuA (A:)
    smetlcqrlnvcqdkilthyendstdlrdhidywkhmrlecaiyykaremgfkhinhqvv
    ptlavsknkalqaielqltletiynsqysnekwtlqdvslevyltaptgcikkhgytvev
    qfdgdicntmhytnwthiyiceeasvtvvegqvdyyglyyvhegirtyfvqfkddaekys
    knkvwevhaggqvilcptsvf
    

  • Chain 'B':
    No sequence available.