PDB entry 2nnl

View 2nnl on RCSB PDB site
Description: Binding of two substrate analogue molecules to dihydroflavonol-4-reductase alters the functional geometry of the catalytic site
Class: oxidoreductase
Keywords: rossmann fold, oxidoreductase
Deposited on 2006-10-24, released 2007-11-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.192
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: dihydroflavonol 4-reductase
    Species: Vitis vinifera [TaxId:29760]
    Gene: DFR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2nnld_
  • Chain 'F':
    Compound: dihydroflavonol 4-reductase
    Species: Vitis vinifera [TaxId:29760]
    Gene: DFR1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2nnlf_
  • Heterogens: NAP, ERD, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2nnlD (D:)
    mgsqsetvcvtgasgfigswlvmrllergytvratvrdptnvkkvkhlldlpkaethltl
    wkadladegsfdeaikgctgvfhvatpmdfeskdpenevikptiegmlgimkscaaaktv
    rrlvftssagtvniqehqlpvydescwsdmefcrakkmtawmyfvsktlaeqaawkyake
    nnidfitiiptlvvgpfimssmppslitalspitgneahysiirqgqfvhlddlcnahiy
    lfenpkaegryicsshdciildlakmlrekypeyniptefkgvdenlksvcfsskkltdl
    gfefkysledmftgavdtcrakgllppshekpvdgkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nnlD (D:)
    etvcvtgasgfigswlvmrllergytvratvrdptnvkkvkhlldlpkaethltlwkadl
    adegsfdeaikgctgvfhvatpmdfeskdpenevikptiegmlgimkscaaaktvrrlvf
    tssagtvniqehqlpvydescwsdmefcrakkmtawmyfvsktlaeqaawkyakennidf
    itiiptlvvgpfimssmppslitalspitgneahysiirqgqfvhlddlcnahiylfenp
    kaegryicsshdciildlakmlrekypeyniptefkgvdenlksvcfsskkltdlgfefk
    ysledmftgavdtcrakgllppsh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2nnlF (F:)
    mgsqsetvcvtgasgfigswlvmrllergytvratvrdptnvkkvkhlldlpkaethltl
    wkadladegsfdeaikgctgvfhvatpmdfeskdpenevikptiegmlgimkscaaaktv
    rrlvftssagtvniqehqlpvydescwsdmefcrakkmtawmyfvsktlaeqaawkyake
    nnidfitiiptlvvgpfimssmppslitalspitgneahysiirqgqfvhlddlcnahiy
    lfenpkaegryicsshdciildlakmlrekypeyniptefkgvdenlksvcfsskkltdl
    gfefkysledmftgavdtcrakgllppshekpvdgkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nnlF (F:)
    setvcvtgasgfigswlvmrllergytvratvrdptnvkkvkhlldlpkaethltlwkad
    ladegsfdeaikgctgvfhvatpmdfeskdpenevikptiegmlgimkscaaaktvrrlv
    ftssagtvniqehqlpvydescwsdmefcrakkmtawmyfvsktlaeqaawkyakennid
    fitiiptlvvgpfimssmppslitalspitgneahysiirqgqfvhlddlcnahiylfen
    pkaegryicsshdciildlakmlrekypeyniptefkgvdenlksvcfsskkltdlgfef
    kysledmftgavdtcrakgllppshe