PDB entry 2nnh

View 2nnh on RCSB PDB site
Description: CYP2C8dH complexed with 2 molecules of 9-cis retinoic acid
Class: oxidoreductase,electron transport
Keywords: CYP2C8; Human P450 2C8; monooxygenases; substrate complex; palmitic acid; 9-cis retinoic acid; panretin, OXIDOREDUCTASE,ELECTRON TRANSPORT
Deposited on 2006-10-24, released 2007-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-16, with a file datestamp of 2016-11-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 2C8
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2C8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nnha_
  • Chain 'B':
    Compound: Cytochrome P450 2C8
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2C8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nnhb_
  • Heterogens: SO4, HEM, 9CR, PLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nnhA (A:)
    makktsskgklppgptplpiignmlqidvkdicksftnfskvygpvftvyfgmnpivvfh
    gyeavkealidngeefsgrgnspisqritkglgiissngkrwkeirrfslttlrnfgmgk
    rsiedrvqeeahclveelrktkaspcdptfilgcapcnvicsvvfqkrfdykdqnfltlm
    krfnenfrilnspwiqvcnnfpllidcfpgthnkvlknvaltrsyirekvkehqasldvn
    nprdfidcflikmeqekdnqksefnienlvgtvadlfvagtettsttlryglllllkhpe
    vtakvqeeidhvigrhrspcmqdrshmpytdavvheiqrysdlvptgvphavttdtkfrn
    ylipkgttimalltsvlhddkefpnpnifdpghfldkngnfkksdyfmpfsagkricage
    glarmelflflttilqnfnlksvddlknlnttavtkgivslppsyqicfipvhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nnhA (A:)
    klppgptplpiignmlqidvkdicksftnfskvygpvftvyfgmnpivvfhgyeavkeal
    idngeefsgrgnspisqritkglgiissngkrwkeirrfslttlrnfgmgkrsiedrvqe
    eahclveelrktkaspcdptfilgcapcnvicsvvfqkrfdykdqnfltlmkrfnenfri
    lnspwiqvcnnfpllidcfpgthnkvlknvaltrsyirekvkehqasldvnnprdfidcf
    likmeqekdnqksefnienlvgtvadlfvagtettsttlryglllllkhpevtakvqeei
    dhvigrhrspcmqdrshmpytdavvheiqrysdlvptgvphavttdtkfrnylipkgtti
    malltsvlhddkefpnpnifdpghfldkngnfkksdyfmpfsagkricageglarmelfl
    flttilqnfnlksvddlknlnttavtkgivslppsyqicfipv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nnhB (B:)
    makktsskgklppgptplpiignmlqidvkdicksftnfskvygpvftvyfgmnpivvfh
    gyeavkealidngeefsgrgnspisqritkglgiissngkrwkeirrfslttlrnfgmgk
    rsiedrvqeeahclveelrktkaspcdptfilgcapcnvicsvvfqkrfdykdqnfltlm
    krfnenfrilnspwiqvcnnfpllidcfpgthnkvlknvaltrsyirekvkehqasldvn
    nprdfidcflikmeqekdnqksefnienlvgtvadlfvagtettsttlryglllllkhpe
    vtakvqeeidhvigrhrspcmqdrshmpytdavvheiqrysdlvptgvphavttdtkfrn
    ylipkgttimalltsvlhddkefpnpnifdpghfldkngnfkksdyfmpfsagkricage
    glarmelflflttilqnfnlksvddlknlnttavtkgivslppsyqicfipvhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nnhB (B:)
    klppgptplpiignmlqidvkdicksftnfskvygpvftvyfgmnpivvfhgyeavkeal
    idngeefsgrgnspisqritkglgiissngkrwkeirrfslttlrnfgmgkrsiedrvqe
    eahclveelrktkaspcdptfilgcapcnvicsvvfqkrfdykdqnfltlmkrfnenfri
    lnspwiqvcnnfpllidcfpgthnkvlknvaltrsyirekvkehqasldvnnprdfidcf
    likmeqekdnqksefnienlvgtvadlfvagtettsttlryglllllkhpevtakvqeei
    dhvigrhrspcmqdrshmpytdavvheiqrysdlvptgvphavttdtkfrnylipkgtti
    malltsvlhddkefpnpnifdpghfldkngnfkksdyfmpfsagkricageglarmelfl
    flttilqnfnlksvddlknlnttavtkgivslppsyqicfipv