PDB entry 2nml

View 2nml on RCSB PDB site
Description: Crystal structure of HEF2/ERH at 1.55 A resolution
Class: transcription
Keywords: HEF2/ERH fold, pseudo beta barrel, interaction network, transcription, cell cycle
Deposited on 2006-10-21, released 2006-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enhancer of rudimentary homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: ERH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nmla1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2nmlA (A:)
mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdf
iddladlsclvyradtqtyqpynkdwikekiyvllrrqaqqagk

    Sequence, based on observed residues (ATOM records): (download) 
    >2nmlA (A:)
shtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdfi
ddladlsclvyradtqtyqpynkdwikekiyvllrrqaqq