PDB entry 2nly

View 2nly on RCSB PDB site
Description: Crystal structure of protein BH1492 from Bacillus halodurans, Pfam DUF610
Class: structural genomics, unknown function
Keywords: divergent polysaccharide deacetylase; pfam04748, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION
Deposited on 2006-10-20, released 2006-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.225
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Divergent polysaccharide deacetylase hypothetical protein
    Species: Bacillus halodurans [TaxId:86665]
    Gene: BH1492
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nlya1
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nlyA (A:)
    gemkraaiiiddfggdvkgvddfltgeipvtvavmpflehstkqaeiaqaaglevivhmp
    lepkkgkiswlgpsgitsnlsvgevksrvrkafddipyavglnnhmgskivenekimrai
    levvkeknafiidsgtsphslipqlaeelevpyatrsifldnthssrkeviknmrklakk
    akqgsepigighvgvrgdetyagirsmldefqaesiqlvpvsqllpspieedhnkfwqqp
    fqake
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nlyA (A:)
    mkraaiiiddfggdvkgvddfltgeipvtvavmpflehstkqaeiaqaaglevivhmple
    pkpsgitsnlsvgevksrvrkafddipyavglnnhmgskivenekimrailevvkeknaf
    iidsgtsphslipqlaeelevpyatrsifldnthssrkeviknmrklakkakqgsepigi
    ghvgvrgdetyagirsmldefqaesiqlvpvsqllp