PDB entry 2nlv

View 2nlv on RCSB PDB site
Description: crystal structure of a xisi-like protein (ava_3825) from anabaena variabilis atcc 29413 at 1.30 a resolution
Class: unknown function
Keywords: XISI-LIKE PROTEIN, STRUCTURAL GENOMICS, JOINT CENTER FOR STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI-2, PSI-Biology, UNKNOWN FUNCTION
Deposited on 2006-10-20, released 2006-12-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: XisI protein-like
    Species: Anabaena variabilis [TaxId:240292]
    Gene: YP_324325.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3M6F6 (1-111)
      • leader sequence (0)
    Domains in SCOPe 2.08: d2nlva1, d2nlva2
  • Chain 'B':
    Compound: XisI protein-like
    Species: Anabaena variabilis [TaxId:240292]
    Gene: YP_324325.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nlvb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nlvA (A:)
    gmdklvkyqelvkklltnyasddvsdqdvevqlildternhyqwmnvgwqglnriyrcvi
    hfdikdgkiwlqqnltdrnpaeelvmmgvpredivlglqapykrqytdygva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nlvB (B:)
    gmdklvkyqelvkklltnyasddvsdqdvevqlildternhyqwmnvgwqglnriyrcvi
    hfdikdgkiwlqqnltdrnpaeelvmmgvpredivlglqapykrqytdygva
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nlvB (B:)
    klvkyqelvkklltnyasddvsdqdvevqlildternhyqwmnvgwqglnriyrcvihfd
    ikdgkiwlqqnltdrnpaeelvmmgvpredivlglqapykrqytdygva