PDB entry 2nlu
View 2nlu on RCSB PDB site
Description: Domain-Swapped Dimer of the PWWP Module of Human Hepatoma-derived Growth Factor
Class: hormone/growth factor
Keywords: HDGF, hHDGF, HRP, HATH, PWWP, Heparin, domain-swapping, HORMONE/GROWTH FACTOR COMPLEX
Deposited on
2006-10-20, released
2007-09-04
The last revision prior to the SCOPe 2.01 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Hepatoma-derived growth factor
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d2nlua1 - Chain 'B':
Compound: Hepatoma-derived growth factor
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d2nlub1
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2nluA (A:)
msrsnrqkeykcgdlvfakmkgyphwparidempeaavkstankyqvfffgthetaflgp
kdlfpyeeskekfgkpnkrkgfseglweiennptvkasgy
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2nluB (B:)
msrsnrqkeykcgdlvfakmkgyphwparidempeaavkstankyqvfffgthetaflgp
kdlfpyeeskekfgkpnkrkgfseglweiennptvkasgy