PDB entry 2nln

View 2nln on RCSB PDB site
Description: Solution Structure of Calcium-free Rat Beta-parvalbumin
Class: metal binding protein
Keywords: calcium-binding protein, rat beta parvalbumin, rat oncomodulin, metal binding protein
Deposited on 2006-10-20, released 2007-09-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oncomodulin
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ocm
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2nlna1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nlnA (A:)
    sitdilsaediaaalqecqdpdtfepqkffqtsglskmsasqvkdifrfidndqsgyldg
    delkyflqkfqsdareltesetkslmdaadndgdgkigadefqemvhs