PDB entry 2nll

View 2nll on RCSB PDB site
Description: retinoid x receptor-thyroid hormone receptor DNA-binding domain heterodimer bound to thyroid response element DNA
Class: transcription/DNA
Keywords: complex (transcription regulation/DNA), DNA-binding, nuclear protein, zinc- finger, multigene family, alternative splicing, receptor, transcription/DNA complex
Deposited on 1996-11-20, released 1997-03-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.206
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (retinoic acid receptor)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19793 (0-65)
  Domains in SCOPe 2.07: d2nlla_
• Chain 'B':
  Compound: protein (thyroid hormone receptor)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10828 (0-102)
    • conflict (101)
  Domains in SCOPe 2.07: d2nllb_
• Chain 'C':
  Compound: DNA (5'-d(*cp*ap*gp*gp*tp*cp*ap*tp*tp*(5iu)p*cp*ap*gp*gp*tp*cp*ap*g)-3')
  
• Chain 'D':
  Compound: DNA (5'-d(*cp*tp*gp*ap*cp*cp*tp*gp*ap*ap*ap*tp*gp*ap*cp*cp*t p*g)-3')
  
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2nllA (A:)
  caicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcqycryqk
  clamgm
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2nllB (B:)
  delcvvcgdkatgyhyrcitcegckgffrrtiqknlhpsysckyegkcvidkvtrnqcqe
  crfkkciyvgmatdlvlddskrlakrklieenrekrrreelek
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.