PDB entry 2nll

View 2nll on RCSB PDB site
Description: retinoid x receptor-thyroid hormone receptor DNA-binding domain heterodimer bound to thyroid response element DNA
Class: transcription/DNA
Keywords: complex (transcription regulation/DNA), DNA-binding, nuclear protein, zinc- finger, multigene family, alternative splicing, receptor, transcription/DNA complex
Deposited on 1996-11-20, released 1997-03-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.206
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (retinoic acid receptor)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nlla_
  • Chain 'B':
    Compound: protein (thyroid hormone receptor)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10828 (0-102)
      • conflict (101)
    Domains in SCOPe 2.07: d2nllb_
  • Chain 'C':
    Compound: DNA (5'-d(*cp*ap*gp*gp*tp*cp*ap*tp*tp*(5iu)p*cp*ap*gp*gp*tp*cp*ap*g)-3')
    Species:
    Gene:
  • Chain 'D':
    Compound: DNA (5'-d(*cp*tp*gp*ap*cp*cp*tp*gp*ap*ap*ap*tp*gp*ap*cp*cp*t p*g)-3')
    Species:
    Gene:
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nllA (A:)
    caicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcqycryqk
    clamgm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nllB (B:)
    delcvvcgdkatgyhyrcitcegckgffrrtiqknlhpsysckyegkcvidkvtrnqcqe
    crfkkciyvgmatdlvlddskrlakrklieenrekrrreelek
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.