PDB entry 2nlj

View 2nlj on RCSB PDB site
Description: Potassium Channel KcsA(M96V)-Fab complex in KCl
Class: membrane protein
Keywords: Voltage-gated channel, Transmembrane, Ionic channel, Ion transport, K Channel, protein-antibody Fab complex, MEMBRANE PROTEIN
Deposited on 2006-10-20, released 2007-05-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: 0.235
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2NLJ (0-211)
    Domains in SCOPe 2.06: d2nlja1, d2nlja2
  • Chain 'B':
    Compound: antibody fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2NLJ (0-End)
    Domains in SCOPe 2.06: d2nljb1, d2nljb2
  • Chain 'C':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Gene: kcsA, skc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (Start-123)
      • engineered (89)
      • engineered (95)
    Domains in SCOPe 2.06: d2nljc_
  • Heterogens: K, DGA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2nljA (A:)
    dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nljB (B:)
    qvqlqqpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygrany
    nekiqkkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssswpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nljB (B:)
    qvqlqqpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygrany
    nekiqkkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssswpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2nljC (C:)
    mapmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaergapgaqli
    typralwwsvetattvgygdlypvtlwgrcvavvvvvagitsfglvtaalatwfvgreqe
    rrgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nljC (C:)
    salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
    ypvtlwgrcvavvvvvagitsfglvtaalatwfvgreqerrgh