PDB entry 2nli

View 2nli on RCSB PDB site
Description: Crystal Structure of the complex between L-lactate oxidase and a substrate analogue at 1.59 angstrom resolution
Class: oxidoreductase
Keywords: L-lactate oxidase, flavoenzyme, FMN, D-Lactate, OXIDOREDUCTASE
Deposited on 2006-10-20, released 2007-10-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.178
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2nlia_
  • Chain 'B':
    Compound: Lactate oxidase
    Species: Aerococcus viridans [TaxId:1377]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2nlib_
  • Heterogens: FMN, LAC, PEO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nliA (A:)
    eynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllypr
    laqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtimsisaysg
    atfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgnrdrdvk
    nkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaghsglpvfvkgiqhp
    edadmaikrgasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehva
    kalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlf
    dnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nliA (A:)
    eynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllypr
    laqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtimsisaysg
    atfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstnrdypfgmpi
    vqrylrgtaegmygaskqkisprdieeiaghsglpvfvkgiqhpedadmaikrgasgiwv
    snhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehvakalasgadvvalgrpv
    lfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlfdnpygyey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2nliB (B:)
    eynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllypr
    laqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtimsisaysg
    atfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgnrdrdvk
    nkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaghsglpvfvkgiqhp
    edadmaikrgasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehva
    kalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlf
    dnpygyey
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nliB (B:)
    eynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllypr
    laqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtimsisaysg
    atfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadsskqkisprdie
    eiaghsglpvfvkgiqhpedadmaikrgasgiwvsnhgarqlyeapgsfdtlpaiaervn
    krvpivfdsgvrrgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrv
    mqltgsqnvedlkgldlfdnpygyey