PDB entry 2nla

View 2nla on RCSB PDB site
Description: Crystal structure of the Mcl-1:mNoxaB BH3 complex
Class: apoptosis
Keywords: Apoptosis, Bcl-2, Mcl-1, Noxa
Deposited on 2006-10-19, released 2007-03-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.211
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FUSION PROTEIN CONSISTING OF Induced myeloid leukemia cell differentiation protein Mcl-1 homolog
    Species: , [TaxId:10116,9606]
    Gene: MCL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2nlaa_
  • Chain 'B':
    Compound: Phorbol-12-myristate-13-acetate-induced protein 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2nlaA (A:)
    eddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqg
    mlrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepl
    aesitdvlvrtkrdwlvkqrgwdgfveffhvedlegg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2nlaA (A:)
    ddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqgm
    lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla
    esitdvlvrtkrdwlvkqrgwdgfveffhv
    

  • Chain 'B':
    No sequence available.